
Western blot - Anti-YAP1/Yap Picoband Antibody
YAP / YAP1 Antibody
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Western Blot |
| Reactivity: | Human |
| Format: | Lyophilized |
$480.00each
Catalog Number: LS-C662437-100
Catalog Number: LS-C662437
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- YAP1 antibody LS-C662437 is an unconjugated rabbit polyclonal antibody to human YAP1 (YAP). Validated for WB.
- Application
- WB
- Reactivity
- Hu
- Intended Use
- Research Use Only
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- 65 kDa Yes-associated protein | YAP | Yes-associated protein beta | Yes-associated protein delta | Yorkie homolog | YAP1 | YAP2 | Yes-associated protein 1 | Yes-associated protein 2 | YKI | YAP65
- UniProt Number
- P46937
- NCBI GenBank
- NM_006106 | NP_006097.2
- SwissProt
- P46937
Target
- Target
- Human YAP / YAP1
- Antigen Species
- Human
- Epitope
- Increased expression seen in some liver and prostate cancers. Isoforms lacking the transactivation domain found in striatal neurons of patients with Huntington disease (at protein level). .
- Gene Name
- YAP1
Antibody
- Host Species
- Rabbit
- Clonality
- Polyclonal
Immunogen
- Immunogen
- A synthetic peptide corresponding to a sequence at the N-Terminus of human YAP1 (62-97 aa ETDLEALFNAVMNPKTANVPQTVPMRLRKLPDSFFK), identical to the related mouse and rat sequences.
- Immunogen Type
- Synthetic Peptide (Linear)
Format
- Conjugate/Label
- Unconjugated
- Format
- Lyophilized
- Formulation
- Lyophilized from 0.2mg Na2HPO4, 5mg BSA, 0.9mg NaCl, 0.05mg sodium azide.
- Preservative
- Yes
- Purification Method
- Affinity Purified
Storage & Handling
- Storage Conditions
- At -20°C for 1 year. After reconstitution, at 4°C for 1 month. It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid freeze-thaw cycles.
- Recommended Storage Buffer
- NaCl
