XRCC6 / Ku70 Antibody
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Immunohistochemistry (general), Immunohistochemistry, Paraffin, Western Blot |
| Reactivity: | Human |
| Format: | Lyophilized |
$587.00each
Catalog Number: LS-C490195-100
Catalog Number: LS-C490195
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- Ku70 antibody LS-C490195 is an unconjugated rabbit polyclonal antibody to human Ku70 (XRCC6). Validated for IHC and WB.
- Application
- IHC, IHC-P, WB
- Reactivity
- Hu
- Intended Use
- Research Use Only
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- 5-dRP lyase Ku70 | 70 kDa subunit of Ku antigen | CTCBF | DNA repair protein XRCC6 | D22S671 | D22S731 | G22P1 | Ku autoantigen, 70kDa | Ku autoantigen p70 subunit | Thyroid-lupus autoantigen p70 | TLAA | XRCC6 | CTC75 | KU70 | ML8 | Thyroid-lupus autoantigen
- Recommended Dilution: IHC-P
- 0.5 - 1 µg/ml
- Recommended Dilution: WB
- 0.1 - 0.5 µg/ml
- UniProt Number
- P12956
- NCBI GenBank
- NM_001469 | NP_001460.1
- SwissProt
- P12956
Target
- Target
- Human XRCC6 / Ku70
- Antigen Species
- Human
- Gene Name
- XRCC6
Antibody
- Host Species
- Rabbit
- Clonality
- Polyclonal
- Isotype
- IgG
Immunogen
- Immunogen
- Amino acids AIVEKLRFTYRSDSFENPVLQQHFRNLEALALD of human Ku70 were used as the immunogen for the Ku70 antibody.
- Immunogen Type
- Peptide
Format
- Conjugate/Label
- Unconjugated
- Format
- Lyophilized
- Formulation
- Lyophilized from PBS, 2.5% BSA, 0.025% sodium azide.
- Preservative
- Yes
- Purification Method
- Affinity Purified
Storage & Handling
- Storage Conditions
- Store at -20°C. Avoid freeze-thaw cycles.
- Recommended Storage Buffer
- PBS