Ku70 antibody Western blot. All lanes: Anti at 0.5 ug/ml. Lane 1: A549 Whole Cell Lysate at 40 ug. Lane 2: HELA Whole Cell Lysate at 40 ug. Lane 3: HEPG2 Whole Cell Lysate at 40 ug. Lane 4: MCF-7 Whole Cell Lysate at 40 ug. Predicted band size: 70 kD. Observed band size: 70 kD.
XRCC6 / Ku70 Antibody (aa464-496)
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Immunohistochemistry (general), Immunohistochemistry, Paraffin, Western Blot |
| Reactivity: | Human |
| Format: | Lyophilized |
$480.00each
Catalog Number: LS-C407734-100
Catalog Number: LS-C407734
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- Ku70 antibody LS-C407734 is an unconjugated rabbit polyclonal antibody to human Ku70 (XRCC6) (aa464-496). Validated for IHC and WB.
- Application
- IHC, IHC-P, WB
- Reactivity
- Hu
- Intended Use
- RUO
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- 5-dRP lyase Ku70 | 70 kDa subunit of Ku antigen | CTCBF | DNA repair protein XRCC6 | D22S671 | D22S731 | G22P1 | Ku autoantigen, 70kDa | Ku autoantigen p70 subunit | Thyroid-lupus autoantigen p70 | TLAA | XRCC6 | CTC75 | KU70 | ML8 | Thyroid-lupus autoantigen
- UniProt Number
- P12956
- NCBI GenBank
- NM_001469, NP_001460.1
- SwissProt
- P12956
Target
- Target
- Human XRCC6 / Ku70
- Antigen Species
- Hu
- Gene Name
- XRCC6
Antibody
- Host Species
- Rb
- Clonality
- Polyclonal
Immunogen
- Immunogen
- A synthetic peptide corresponding to a sequence at C-Terminus of human Ku70 (464-496 aa AIVEKLRFTYRSDSFENPVLQQHFRNLEALALD), different from the related mouse sequence by one amino acid.
- Immunogen Type
- SP-Lin
Format
- Conjugate/Label
- Unconj
- Format
- Lyophilized
- Formulation
- Lyophilized from 0.2mg Na2HPO4, 5mg BSA, 0.9mg NaCl, 0.05mg sodium azide.
- Preservative
- Yes
- Purification Method
- AP
Storage & Handling
- Storage Conditions
- At -20°C for 1 year. After reconstitution, at 4°C for 1 month. It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid freeze-thaw cycles.
- Recommended Storage Buffer
- NaCl