
Western blot testing of 1) rat testis, 2) mouse testis and 3) human HeLa lysate with Exportin-5 antibody at 0.5ug/ml. Predicted molecular weight ~136 kDa.
XPO5 / Exportin 5 Antibody
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Western Blot |
| Reactivity: | Human, Mouse, Rat |
| Format: | Lyophilized |
$587.00each
Catalog Number: LS-C782043-100
Catalog Number: LS-C782043
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- Exportin 5 antibody LS-C782043 is an unconjugated rabbit polyclonal antibody to Exportin 5 (XPO5) from human. It is reactive with human, mouse and rat. Validated for WB.
- Application
- WB
- Reactivity
- Hu, Ms, Rt
- Intended Use
- Research Use Only
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- Exportin 5 | Exportin-5 | Ran-binding protein 21 | XPO5 | Exp5 | KIAA1291 | RANBP21
- Recommended Dilution: WB
- 0.5 - 1 µg/ml
- UniProt Number
- Q9HAV4
- NCBI GenBank
- NM_020750 | NP_065801.1
- SwissProt
- Q9HAV4
Target
- Target
- Human XPO5 / Exportin 5
- Antigen Species
- Human
- Gene Name
- XPO5
Antibody
- Host Species
- Rabbit
- Clonality
- Polyclonal
- Isotype
- IgG
- Origin Species
- Human
Immunogen
- Immunogen
- Amino acids 2-43 (AMDQVNALCEQLVKAVTVMMDPNSTQRYRLEALKFCEEFKEK) were used as the immunogen for the Exportin-5 antibody.
Format
- Conjugate/Label
- Unconjugated
- Format
- Lyophilized
- Formulation
- Lyophilized from PBS, 2.5% BSA, 0.025% sodium azide.
- Preservative
- Yes
- Purification Method
- Affinity Purified
Storage & Handling
- Storage Conditions
- After reconstitution, store at 4°C for up to 1 month. Long-term: aliquot and store at -20°C. Avoid freeze-thaws cycles.
- Recommended Storage Buffer
- PBS
