Western blot analysis of extracts of rat lung, using VKORC1L1 antibody at 1:1000 dilution. The secondary antibody used was an HRP Goat Anti-Rat IgG (H+L) (AS028) at 1:10000 dilution. Lysates were loaded 25ug per lane and 3% nonfat dry milk in TBST was used for blocking. An ECL Kit was used for detection and the exposure time was 10s.

VKORC1L1 Antibody

Primary AntibodyLSBio Guarantee

Antibody:	Rat Polyclonal
Applications:	Western Blot
Reactivity:	Rat
Format:	Liquid

$281.00each

Catalog Number: LS-C497309-20

Unit Size

Quantity

For bulk orders or custom formulations:

Overview

Description: VKORC1L1 antibody LS-C497309 is an unconjugated rat polyclonal antibody to rat VKORC1L1. Validated for WB.
Application: WB
Reactivity: Rt
Intended Use: Research Use Only
Guarantees: This antibody carries the LSBio 100% Guarantee. ✓
Category: Antibodies > Primary Antibodies > Polyclonal Antibodies
Alternative Names: VKORC1-like protein 1 | VKORC1L1
Recommended Dilution: WB: 1:500 - 1:2000
UniProt Number: Q8N0U8
SwissProt: Q8N0U8

Target

Target: Mouse VKORC1L1
Antigen Species: Mouse
Gene Name: VKORC1L1

Antibody

Host Species: Rat
Clonality: Polyclonal

Immunogen

Immunogen: A synthetic peptide corresponding to a sequence within amino acids 100 to the C-Terminus of mouse VKORC1L1 (NP_081397.1). LLGMTASAVAALVLMTSSIVSVVGSLYLAYILYFVLKEFCIICVTTYVLNFLLLIINYKRLVYLNEAWKRQLQPKED
Immunogen Type: Synthetic Peptide (Linear)