Western blot analysis of extracts of various cell lines.
VISA / MAVS Antibody
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Immunofluorescence, Immunohistochemistry (general), Immunoprecipitation, Western Blot |
| Reactivity: | Human, Mouse, Rat |
| Format: | Liquid |
$281.00each
Catalog Number: LS-C334271-20
Catalog Number: LS-C334271
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- MAVS antibody LS-C334271 is an unconjugated rabbit polyclonal antibody to MAVS (VISA) from human. It is reactive with human, mouse and rat. Validated for IF, IHC, IP and WB.
- Application
- IF, IHC, IP, WB
- Reactivity
- Hu, Ms, Rt
- Intended Use
- Research Use Only
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- CARDIF | CARD adaptor inducing IFN-beta | IPS-1 | KIAA1271 | IFN-B promoter stimulator 1 | VISA | IPS1 | MAVS
- Recommended Dilution: IF/ICC
- 1:20 - 1:100
- Recommended Dilution: IHC
- 1:50 - 1:200
- Recommended Dilution: IP
- 1:20 - 1:100
- Recommended Dilution: WB
- 1:500 - 1:2000
- UniProt Number
- Q7Z434
- NCBI GenBank
- NM_020746 | NP_065797.2
- SwissProt
- Q7Z434
Target
- Target
- Human VISA / MAVS
- Antigen Species
- Human
- Epitope
- Human VISA / MAVS
- Gene Name
- MAVS
Antibody
- Host Species
- Rabbit
- Clonality
- Polyclonal
- Isotype
- IgG
Immunogen
- Immunogen
- Recombinant fusion protein containing a sequence corresponding to amino acids 1-65 of human MAVS (NP_065797.2). MPFAEDKTYKYICRNFSNFCNVDVVEILPYLPCLTARDQDRLRATCTLSGNRDTLWHLFNTLQRR
- Immunogen Type
- Fusion Protein (e.g., GST, MBP tag)
Format
- Conjugate/Label
- Unconjugated
- Format
- Liquid
- Formulation
- PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
- Volume
- 20 Microliter
- Preservative
- Yes
- Purification Method
- Affinity Purified
Storage & Handling
- Storage Conditions
- Store at -20°C. Avoid freeze-thaw cycles.
- Recommended Storage Buffer
- PBS