
Western blot blot of extract of various cells, using AGGF1 antibody.
VG5Q / AGGF1 Antibody
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Western Blot |
| Reactivity: | Human |
| Format: | Liquid |
$281.00each
Catalog Number: LS-C409764-20
Catalog Number: LS-C409764
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- AGGF1 antibody LS-C409764 is an unconjugated rabbit polyclonal antibody to human AGGF1 (VG5Q). Validated for WB.
- Application
- WB
- Reactivity
- Hu
- Intended Use
- Research Use Only
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- Angiogenic factor VG5Q | AGGF1 | HVG5Q | HUS84971 | VG5Q | GPATC7 | GPATCH7 | HSU84971
- Recommended Dilution: WB
- 1:500 - 1:2000
- UniProt Number
- Q8N302
- NCBI GenBank
- NM_018046 | NP_060516.2
- SwissProt
- Q8N302
Target
- Target
- Human VG5Q / AGGF1
- Antigen Species
- Human
- Epitope
- Human VG5Q / AGGF1
- Gene Name
- AGGF1
Antibody
- Host Species
- Rabbit
- Clonality
- Polyclonal
- Isotype
- IgG
Immunogen
- Immunogen
- Recombinant fusion protein containing a sequence corresponding to amino acids 1-70 of human AGGF1 (NP_060516.2). MASEAPSPPRSPPPPTSPEPELAQLRRKVEKLERELRSCKRQVREIEKLLHHTERLYQNAESNNQELRTQ
- Immunogen Type
- Fusion Protein (e.g., GST, MBP tag)
Format
- Conjugate/Label
- Unconjugated
- Format
- Liquid
- Formulation
- PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
- Volume
- 20 Microliter
- Preservative
- Yes
- Purification Method
- Affinity Purified
Storage & Handling
- Storage Conditions
- Store at -20°C. Avoid freeze-thaw cycles.
- Recommended Storage Buffer
- PBS
