Western blot. MBP-VEGFA isoform 6 recombinant protein detected by WB using anti-VEGFA antibody at 1000 dilution. Rabbit polyclonal to goat IgG (HRP) at 1:10000 dilution.
VEGFA / VEGF Antibody
Primary AntibodyLSBio Guarantee
| Antibody: | Goat Polyclonal |
| Applications: | Immunofluorescence, Immunohistochemistry (general), Western Blot |
| Reactivity: | Dog, Human, Mouse, Non-Human Primate, Rat |
| Format: | Liquid |
$418.00each
Catalog Number: LS-C204251-600
Catalog Number: LS-C204251
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- VEGF antibody LS-C204251 is an unconjugated goat polyclonal antibody to VEGF (VEGFA) from human. It is reactive with human, mouse, rat and other species. Validated for IF and WB.
- Application
- IF, IHC, WB
- Reactivity
- Can, Hu, Ms, NHP, Rt
- Intended Use
- Research Use Only
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- VPF | Vascular permeability factor | VEGF | VEGF-A | MVCD1 | VEGFA
- Recommended Dilution: IF/ICC
- 1:50 - 1:250
- Recommended Dilution: WB
- 1:500 - 1:2000
- UniProt Number
- P15692
- NCBI GenBank
- NM_003376 | NP_003367.4
- SwissProt
- P15692
Target
- Target
- Human VEGFA / VEGF
- Antigen Species
- Human
- Epitope
- Detects endogenous levels of total VEGFA by Western blot in whole cell and tissue lysates.
- Gene Name
- VEGFA
Antibody
- Host Species
- Goat
- Clonality
- Polyclonal
- Isotype
- IgG
Immunogen
- Immunogen
- Purified recombinant human VEGFA isoform 6 produced in E. coli. corresponding to P15692-6 (MNFLLSWVHWSLALLLYLHHAKWSQAAPMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVD)
- Immunogen Type
- Recombinant Immunogen
Format
- Conjugate/Label
- Unconjugated
- Format
- Liquid
- Formulation
- PBS, 0.05% Sodium Azide, 20% Glycerol
- Concentration
- 3 mg/mL
- Preservative
- Yes
- Purification Method
- Affinity Purified
Storage & Handling
- Storage Conditions
- Short term: store at 4°C. Long term: aliquot and store at -20°C. Avoid freeze-thaw cycles.
- Recommended Storage Buffer
- PBS