
Western blot analysis of extracts of various cell lines.
UTS2 / Urotensin II Antibody
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Immunohistochemistry (general), Western Blot |
| Reactivity: | Human, Mouse |
| Format: | Liquid |
$281.00each
Catalog Number: LS-C335560-20
Catalog Number: LS-C335560
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- Urotensin II antibody LS-C335560 is an unconjugated rabbit polyclonal antibody to Urotensin II (UTS2) from human. It is reactive with human and mouse. Validated for IHC and WB.
- Application
- IHC, WB
- Reactivity
- Hu, Ms
- Intended Use
- Research Use Only
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- Urotensin 2 | U-II | Urotensin II | UTS2 | PRO1068 | UII | Urotensin-2
- Recommended Dilution: IHC
- 1:50 - 1:200
- Recommended Dilution: WB
- 1:500 - 1:2000
- UniProt Number
- O95399
- NCBI GenBank
- NM_006786 | NP_006777.1
- SwissProt
- O95399
Target
- Target
- Human UTS2 / Urotensin II
- Antigen Species
- Human
- Epitope
- Human UTS2 / Urotensin II
- Gene Name
- UTS2
Antibody
- Host Species
- Rabbit
- Clonality
- Polyclonal
- Isotype
- IgG
Immunogen
- Immunogen
- Recombinant fusion protein containing a sequence corresponding to amino acids 35-124 of human UTS2 (NP_006777.1). APHEDARLTPEELERASLLQILPEMLGAERGDILRKADSSTNIFNPRGNLRKFQDFSGQDPNILLSHLLARIWKPYKKRETPDCFWKYCV
- Immunogen Type
- Fusion Protein (e.g., GST, MBP tag)
Format
- Conjugate/Label
- Unconjugated
- Format
- Liquid
- Formulation
- PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
- Volume
- 20 Microliter
- Preservative
- Yes
- Purification Method
- Affinity Purified
Storage & Handling
- Storage Conditions
- Store at -20°C. Avoid freeze-thaw cycles.
- Recommended Storage Buffer
- PBS
