Western blot analysis of extract of various cells.
UQCR10 / UCRC Antibody
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Immunohistochemistry (general), Western Blot |
| Reactivity: | Human, Mouse, Rat |
| Format: | Liquid |
$281.00each
Catalog Number: LS-C408783-20
Catalog Number: LS-C408783
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- UCRC antibody LS-C408783 is an unconjugated rabbit polyclonal antibody to UCRC (UQCR10) from human. It is reactive with human, mouse and rat. Validated for IHC and WB.
- Application
- IHC, WB
- Reactivity
- Hu, Ms, Rt
- Intended Use
- Research Use Only
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- Complex III subunit X | HSPC151 | HSPC051 | UCCR7.2 | UQCR10 | QCR9 | Complex III subunit 9 | HSPC119 | UCRC
- Recommended Dilution: IHC
- 1:50 - 1:100
- Recommended Dilution: WB
- 1:500 - 1:2000
- UniProt Number
- Q9UDW1
- NCBI GenBank
- NM_013387 | NP_037519.2
- SwissProt
- Q9UDW1
Target
- Target
- Human UQCR10 / UCRC
- Antigen Species
- Human
- Epitope
- Human UQCR10 / UCRC
- Gene Name
- UQCR10
Antibody
- Host Species
- Rabbit
- Clonality
- Polyclonal
- Isotype
- IgG
Immunogen
- Immunogen
- Recombinant fusion protein containing a sequence corresponding to amino acids 1-63 of human UQCR10 (NP_037519.2). MAAATLTSKLYSLLFRRTSTFALTIIVGVMFFERAFDQGADAIYDHINEGKLWKHIKHKYENK
- Immunogen Type
- Fusion Protein (e.g., GST, MBP tag)
Format
- Conjugate/Label
- Unconjugated
- Format
- Liquid
- Formulation
- PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
- Volume
- 20 Microliter
- Preservative
- Yes
- Purification Method
- Affinity Purified
Storage & Handling
- Storage Conditions
- Store at -20°C. Avoid freeze-thaw cycles.
- Recommended Storage Buffer
- PBS