Human Apolipoprotein H Antibody (IgG) ELISA Kit (Sandwich ELISA)
Catalog Number: LS-F67372-1
1 plate / $591.00
Reactivity: Human
Detection Method Colorimetric
Format: 96-Well Strip Plate
UPF3B/RENT3B antibody Western blot. All lanes: Anti UPF3B/RENT3B at 0.5 ug/ml. Lane 1: Rat Cardiac Muscle Tissue Lysate at 50 ug. Lane 2: Rat Brain Tissue Lysate at 50 ug. Lane 3: HELA Whole Cell Lysate at 40 ug. Lane 4: 22RV1 Whole Cell Lysate at 40 ug. Lane 5: U87 Whole Cell Lysate at 40 ug. Lane 6: JURKAT Whole Cell Lysate at 40 ug. Predicted band size: 58 kD. Observed band size: 58 kD.
UPF3B Antibody (aa416-452)
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Immunohistochemistry (general), Immunohistochemistry, Paraffin, Western Blot |
| Reactivity: | Dog, Horse, Human, Mouse, Pig, Rabbit, Rat, Sheep |
| Format: | Lyophilized |
$480.00each
Catalog Number: LS-C408055-100
Catalog Number: LS-C408055
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- UPF3B antibody LS-C408055 is an unconjugated rabbit polyclonal antibody to UPF3B (aa416-452) from human. It is reactive with human, mouse, rat and other species. Validated for IHC and WB.
- Application
- IHC, IHC-P, WB
- Reactivity
- Can, Hr, Hu, Ms, Por, Rb, Rt, Sh
- Intended Use
- Research Use Only
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- HUPF3B | MRXS14 | HUpf3p-X | RENT3B | UPF3X | UPF3B
- UniProt Number
- Q9BZI7
- NCBI GenBank
- NM_023010 | NP_075386.1
- SwissProt
- Q9BZI7
Target
- Target
- Human UPF3B
- Antigen Species
- Human
- Epitope
- Expressed in testis, uterus, prostate, heart, muscle, brain, spinal cord and placenta. .
- Gene Name
- UPF3B
Antibody
- Host Species
- Rabbit
- Clonality
- Polyclonal
Immunogen
- Immunogen
- A synthetic peptide corresponding to a sequence at the C-Terminus of human UPF3B /RENT3B (416-452 aa SEKTEKKEEVVKRDRIRNKDRPAMQLYQPGARSRNRL).
- Immunogen Type
- Synthetic Peptide (Linear)
Format
- Conjugate/Label
- Unconjugated
- Format
- Lyophilized
- Formulation
- Lyophilized from 0.2mg Na2HPO4, 5mg BSA, 0.9mg NaCl, 0.05mg sodium azide.
- Preservative
- Yes
- Purification Method
- Affinity Purified
Storage & Handling
- Storage Conditions
- At -20°C for 1 year. After reconstitution, at 4°C for 1 month. It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid freeze-thaw cycles.
- Recommended Storage Buffer
- NaCl
