
Western blot analysis of extracts of various cell lines, using UBQLN1 antibody at 1:1000 dilution. The secondary antibody used was an HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates were loaded 25ug per lane and 3% nonfat dry milk in TBST was used for blocking. An ECL Kit was used for detection and the exposure time was 10s.
UBQLN1 / Ubiquilin Antibody
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Western Blot |
| Reactivity: | Human, Mouse, Rat |
| Format: | Liquid |
$281.00each
Catalog Number: LS-C750409-20
Catalog Number: LS-C750409
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- Ubiquilin antibody LS-C750409 is an unconjugated rabbit polyclonal antibody to Ubiquilin (UBQLN1) from human. It is reactive with human, mouse and rat. Validated for WB.
- Application
- WB
- Reactivity
- Hu, Ms, Rt
- Intended Use
- Research Use Only
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- DA41 | HPLIC-1 | PLIC-1 | Ubiquilin | UBQLN1 | UBQN | XDRP1 | DSK2 | PLIC1 | Ubiquilin 1 | Ubiquilin-1
- UniProt Number
- Q9UMX0
- NCBI GenBank
- NM_013438
- SwissProt
- Q9UMX0
Recommended Dilution
| Application | Dilution |
|---|---|
| WB | 1:200 - 1:2000 |
Target
- Target
- Human UBQLN1 / Ubiquilin
- Antigen Species
- Human
- Gene Name
- UBQLN1
Antibody
- Host Species
- Rabbit
- Clonality
- Polyclonal
- Isotype
- IgG
- Origin Species
- Human
Immunogen
- Immunogen
- Recombinant fusion protein containing a sequence corresponding to amino acids 480-540 of human UBQLN1 (NP_038466.2). LIPGFTPGLGALGSTGGSSGTNGSNATPSENTSPTAGTTEPGHQQFIQQMLQALAGVNPQL
- Immunogen Type
- Fusion Protein (e.g., GST, MBP tag)
Format
- Conjugate/Label
- Unconjugated
- Format
- Liquid
- Formulation
- PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
- Volume
- 20 Microliter
- Preservative
- Yes
- Purification Method
- Affinity Purified
Storage & Handling
- Storage Conditions
- Store at -20°C. Avoid freeze-thaw cycles.
- Recommended Storage Buffer
- PBS
