Human Apolipoprotein H Antibody (IgG) ELISA Kit (Sandwich ELISA)
Catalog Number: LS-F67372-1
1 plate / $591.00
Reactivity: Human
Detection Method Colorimetric
Format: 96-Well Strip Plate
UBE2Q2 antibody Western blot. All lanes: Anti UBE2Q2 at 0.5 ug/ml. Lane 1: HELA Whole Cell Lysate at 40 ug. Lane 2: A431 Whole Cell Lysate at 40 ug. Lane 3: MCF-7 Whole Cell Lysate at 40 ug. Lane 4: SW620 Whole Cell Lysate at 40 ug. Predicted band size: 50 kD. Observed band size: 50 kD.
UBE2Q2 Antibody (aa83-123)
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Immunohistochemistry (general), Immunohistochemistry, Paraffin, Western Blot |
| Reactivity: | Human |
| Format: | Lyophilized |
$480.00each
Catalog Number: LS-C408052-100
Catalog Number: LS-C408052
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- UBE2Q2 antibody LS-C408052 is an unconjugated rabbit polyclonal antibody to human UBE2Q2 (aa83-123). Validated for IHC and WB.
- Application
- IHC, IHC-P, WB
- Reactivity
- Hu
- Intended Use
- Research Use Only
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- LOC92912 | UBE2Q2 | Ubiquitin-protein ligase Q2 | Ubiquitin carrier protein Q2
- UniProt Number
- Q8WVN8
- NCBI GenBank
- NP_775740.1
- SwissProt
- Q8WVN8
Target
- Target
- Human UBE2Q2
- Antigen Species
- Human
- Epitope
- Detected in hypopharyngeal head and neck squamous cell carcinoma, in tumor masses and invasive epithelium. .
- Gene Name
- UBE2Q2
Antibody
- Host Species
- Rabbit
- Clonality
- Polyclonal
Immunogen
- Immunogen
- A synthetic peptide corresponding to a sequence at the N-Terminus of human UBE2Q2 (83-123 aa LERLEDTKNNNLLRQQLKWLICELCSLYNLPKHLDVEMLDQ), different from the related mouse sequence by four amino acids.
- Immunogen Type
- Synthetic Peptide (Linear)
Format
- Conjugate/Label
- Unconjugated
- Format
- Lyophilized
- Formulation
- Lyophilized from 0.2mg Na2HPO4, 5mg BSA, 0.9mg NaCl, 0.05mg sodium azide.
- Preservative
- Yes
- Purification Method
- Affinity Purified
Storage & Handling
- Storage Conditions
- At -20°C for 1 year. After reconstitution, at 4°C for 1 month. It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid freeze-thaw cycles.
- Recommended Storage Buffer
- NaCl
