
IF analysis of UBE2I/UBC9 using anti-UBE2I/UBC9 antibody UBE2I/UBC9 was detected in immunocytochemical section of U20S cell. Enzyme antigen retrieval was performed using IHC enzyme antigen retrieval reagent for 15 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 2µg/mL rabbit anti-UBE2I/UBC9 Antibody overnight at 4°C. DyLight®488 Conjugated Goat Anti-Rabbit IgG was used as secondary antibody at 1:100 dilution and incubated for 30 minutes at 37°C. The section was counterstained with DAPI. Visualize using a fluorescence microscope and filter sets appropriate for the label used.
UBE2I / UBC9 Antibody
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Immunohistochemistry, Paraffin, Western Blot |
| Reactivity: | Human, Mouse, Rat |
| Format: | Lyophilized |
$480.00each
Catalog Number: LS-C756540-100
Catalog Number: LS-C756540
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- UBC9 antibody LS-C756540 is an unconjugated rabbit polyclonal antibody to UBC9 (UBE2I) from human. It is reactive with human, mouse and rat. Validated for IHC and WB.
- Application
- IHC-P, WB
- Reactivity
- Hu, Ms, Rt
- Intended Use
- Research Use Only
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- C358B7.1 | SUMO-conjugating enzyme UBC9 | UBE2I | UBC9 | SUMO-protein ligase | UBCE9 | Ubiquitin carrier protein 9 | Ubiquitin carrier protein I | Ubiquitin-protein ligase I | p18 | SUMO-1-protein ligase | Ubiquitin conjugating enzyme 9 | Ubiquitin-protein ligase E2I
- UniProt Number
- P63279
- NCBI GenBank
- NM_003345 | NP_003336.1
- SwissProt
- P63279
Recommended Dilution
| Application | Dilution |
|---|---|
| IHC-P | 0.5 - 1 µg/ml |
| WB | 0.1 - 0.5 µg/ml |
Target
- Target
- Human UBE2I / UBC9
- Antigen Species
- Human
- Epitope
- No cross reactivity with other proteins.
- Gene Name
- UBE2I
Antibody
- Host Species
- Rabbit
- Clonality
- Polyclonal
- Isotype
- IgG
- Origin Species
- Human
Immunogen
- Immunogen
- A synthetic peptide corresponding to a sequence of human UBE2I UBC9 (NIQDPAQAEAYTIYCQNRVEYEKRVRAQAKKFAPS).
- Immunogen Type
- Synthetic Peptide (Linear)
Format
- Conjugate/Label
- Unconjugated
- Format
- Lyophilized
- Formulation
- Lyophilized from 0.2mg Na2HPO4, 0.9mg NaCl, 0.05mg sodium azide, 4mg Trehalose
- Preservative
- Yes
- Purification Method
- Affinity Purified
Storage & Handling
- Storage Conditions
- After reconstitution, may be stored at 4°C for 1 month. For long-term storage and to avoid freeze-thaw cycles, aliquot and store at -20°C.
- Recommended Storage Buffer
- NaCl
