
Immunofluorescence analysis of MCF7 cell using TWIST1 antibody. Blue: DAPI for nuclear staining.
TWIST1 / TWIST Antibody
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Immunofluorescence, Immunohistochemistry (general) |
| Reactivity: | Human, Mouse |
| Format: | Liquid |
$281.00each
Catalog Number: LS-C346358-20
Catalog Number: LS-C346358
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- TWIST antibody LS-C346358 is an unconjugated rabbit polyclonal antibody to TWIST (TWIST1) from human. It is reactive with human and mouse. Validated for IF.
- Application
- IF, IHC
- Reactivity
- Hu, Ms
- Intended Use
- Research Use Only
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- ACS3 | Acrocephalosyndactyly 3 | B-HLH DNA binding protein | BHLHa38 | BPES2 | BPES3 | CRS1 | SCS | TWIST | TWIST1 | H-twist | Twist homolog 1 (Drosophila) | TWIST homolog of drosophila | Twist-related protein 1
- Recommended Dilution: IF/ICC
- 1:50 - 1:100
- UniProt Number
- Q15672
- NCBI GenBank
- NM_000474 | NP_000465.1
- SwissProt
- Q15672
Target
- Target
- Human TWIST1 / TWIST
- Antigen Species
- Human
- Epitope
- Human TWIST1 / TWIST
- Gene Name
- TWIST1
Antibody
- Host Species
- Rabbit
- Clonality
- Polyclonal
- Isotype
- IgG
Immunogen
- Immunogen
- Recombinant fusion protein containing a sequence corresponding to amino acids 103-202 of human TWIST1 (NP_000465.1). YEELQTQRVMANVRERQRTQSLNEAFAALRKIIPTLPSDKLSKIQTLKLAARYIDFLYQVLQSDELDSKMASCSYVAHERLSYAFSVWRMEGAWSMSASH
- Immunogen Type
- Fusion Protein (e.g., GST, MBP tag)
Format
- Conjugate/Label
- Unconjugated
- Format
- Liquid
- Formulation
- PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
- Volume
- 20 Microliter
- Preservative
- Yes
- Purification Method
- Affinity Purified
Storage & Handling
- Storage Conditions
- Store at -20°C. Avoid freeze-thaw cycles.
- Recommended Storage Buffer
- PBS
