
Western blot analysis of extracts of various cells.
TSPAN7 / CD231 Antibody
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Immunofluorescence, Western Blot |
| Reactivity: | Rat |
| Format: | Liquid |
$281.00each
Catalog Number: LS-C334700-20
Catalog Number: LS-C334700
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- CD231 antibody LS-C334700 is an unconjugated rabbit polyclonal antibody to rat CD231 (TSPAN7). Validated for IF and WB.
- Application
- IF, WB
- Reactivity
- Rt
- Intended Use
- Research Use Only
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- A15 | CD231 antigen | Cell surface glycoprotein A15 | CD231 | DXS1692E | MXS1 | TALLA-1 | Tetraspanin 7 | Transmembrane protein A15 | TSPAN7 | Tetraspanin protein | Tspan-7 | TM4SF2 | CCG-B7 | MRX58 | Tetraspanin-7 | TM4SF2b | Transmembrane 4 superfamily 2b
- UniProt Number
- P41732
- NCBI GenBank
- NM_004615 | NP_004606.2
- SwissProt
- P41732
Recommended Dilution
| Application | Dilution |
|---|---|
| WB | 1:500 - 1:2000 |
Target
- Target
- Human TSPAN7 / CD231
- Antigen Species
- Human
- Epitope
- Human and rat TSPAN7 / CD231.
- Gene Name
- TSPAN7
Antibody
- Host Species
- Rabbit
- Clonality
- Polyclonal
- Isotype
- IgG
Immunogen
- Immunogen
- Recombinant fusion protein containing a sequence corresponding to amino acids 113-213 of human TSPAN7 (NP_004606.2). RHEIKDTFLRTYTDAMQTYNGNDERSRAVDHVQRSLSCCGVQNYTNWSTSPYFLEHGIPPSCCMNETDCNPQDLHNLTVAATKVNQKGCYDLVTSFMETNM
- Immunogen Type
- Fusion Protein (e.g., GST, MBP tag)
Format
- Conjugate/Label
- Unconjugated
- Format
- Liquid
- Formulation
- PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
- Volume
- 20 Microliter
- Preservative
- Yes
- Purification Method
- Affinity Purified
Storage & Handling
- Storage Conditions
- Store at -20°C. Avoid freeze-thaw cycles.
- Recommended Storage Buffer
- PBS
