Western blot analysis of extracts of Mouse brain cells.
TSPAN33 / PEN Antibody
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Immunohistochemistry (general), Western Blot |
| Reactivity: | Human, Mouse, Rat |
| Format: | Liquid |
$281.00each
Catalog Number: LS-C333932-20
Catalog Number: LS-C333932
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- PEN antibody LS-C333932 is an unconjugated rabbit polyclonal antibody to PEN (TSPAN33) from human. It is reactive with human, mouse and rat. Validated for IHC and WB.
- Application
- IHC, WB
- Reactivity
- Hu, Ms, Rt
- Intended Use
- Research Use Only
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- HPen | PEN | Tetraspanin 33 | TSPAN33 | Tetraspanin-33 | Penumbra | Proerythroblast new membrane | Tspan-33
- Recommended Dilution: IHC
- 1:50 - 1:200
- Recommended Dilution: WB
- 1:200 - 1:1000
- UniProt Number
- Q86UF1
- SwissProt
- Q86UF1
Target
- Target
- Human TSPAN33 / PEN
- Antigen Species
- Human
- Epitope
- Human TSPAN33 / PEN
- Gene Name
- TSPAN33
Antibody
- Host Species
- Rabbit
- Clonality
- Polyclonal
- Isotype
- IgG
Immunogen
- Immunogen
- A synthetic peptide corresponding to a sequence within amino acids 200 to the C-Terminus of human TSPAN33 (NP_848657.1). NTMCGQGMQAFDYLEASKVIYTNGCIDKLVNWIHSNLFLLGGVALGLAIPQLVGILLSQILVNQIKDQIKLQLYNQQHRADPWY
- Immunogen Type
- Synthetic Peptide (Linear)
Format
- Conjugate/Label
- Unconjugated
- Format
- Liquid
- Formulation
- PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
- Volume
- 20 Microliter
- Preservative
- Yes
- Purification Method
- Affinity Purified
Storage & Handling
- Storage Conditions
- Store at -20°C. Avoid freeze-thaw cycles.
- Recommended Storage Buffer
- PBS