Human Apolipoprotein H Antibody (IgG) ELISA Kit (Sandwich ELISA)
Catalog Number: LS-F67372-1
1 plate / $591.00
Reactivity: Human
Detection Method Colorimetric
Format: 96-Well Strip Plate
Western blot - Anti-TSLP Picoband Antibody
TSLP Antibody
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Western Blot |
| Reactivity: | Mouse |
| Format: | Lyophilized |
$480.00each
Catalog Number: LS-C662062-100
Catalog Number: LS-C662062
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- TSLP antibody LS-C662062 is an unconjugated rabbit polyclonal antibody to mouse TSLP. Validated for WB.
- Application
- WB
- Reactivity
- Ms
- Intended Use
- Research Use Only
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- TSLP | Thymic stromal lymphopoietin
- UniProt Number
- Q969D9
- NCBI GenBank
- NM_033035 | NP_149024.1
- SwissProt
- Q969D9
Target
- Target
- Mouse TSLP
- Antigen Species
- Mouse
- Gene Name
- TSLP
Antibody
- Host Species
- Rabbit
- Clonality
- Polyclonal
Immunogen
- Immunogen
- A synthetic peptide corresponding to a sequence of mouse TSLP (QEMAQEVQNICLNQTSQILRLWYSFMQSPE).
- Immunogen Type
- Synthetic Peptide (Linear)
Format
- Conjugate/Label
- Unconjugated
- Format
- Lyophilized
- Formulation
- Lyophilized from 0.2mg Na2HPO4, 5mg BSA, 0.9mg NaCl, 0.05mg sodium azide.
- Preservative
- Yes
- Purification Method
- Affinity Purified
Storage & Handling
- Storage Conditions
- At -20°C for 1 year. After reconstitution, at 4°C for 1 month. It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid freeze-thaw cycles.
- Recommended Storage Buffer
- NaCl
