Western blot - Anti-Alpha Defensin 1 Picoband Antibody
TRIM24 / TIF1 Antibody
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Western Blot |
| Reactivity: | Human |
| Format: | Lyophilized |
$480.00each
Catalog Number: LS-C662275-100
Catalog Number: LS-C662275
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- TIF1 antibody LS-C662275 is an unconjugated rabbit polyclonal antibody to human TIF1 (TRIM24). Validated for WB.
- Application
- WB
- Reactivity
- Hu
- Intended Use
- Research Use Only
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- TF1A | TIF1 | TIF1A | TRIM24 | Tripartite motif-containing 24 | TIF1ALPHA | PTC6 | RNF82 | TIF1-alpha | Tripartite motif containing 24 | HTIF1 | RING finger protein 82
- UniProt Number
- O15164
- NCBI GenBank
- AAD17258.1 | AF119042
- SwissProt
- O15164
Target
- Target
- Human TRIM24 / TIF1
- Antigen Species
- Human
- Gene Name
- TRIM24
Antibody
- Host Species
- Rabbit
- Clonality
- Polyclonal
Immunogen
- Immunogen
- A synthetic peptide corresponding to a sequence at the C-Terminus of human Alpha Defensin 1 (65-94 aa ACYCRIPACIAGERRYGTCIYQGRLWAFCC).
- Immunogen Type
- Synthetic Peptide (Linear)
Format
- Conjugate/Label
- Unconjugated
- Format
- Lyophilized
- Formulation
- Lyophilized from 0.2mg Na2HPO4, 0.9mg NaCl, 0.05mg sodium azide, 4mg Trehalose
- Preservative
- Yes
- Purification Method
- Affinity Purified
Storage & Handling
- Storage Conditions
- At -20°C for 1 year. After reconstitution, at 4°C for 1 month. It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid freeze-thaw cycles.
- Recommended Storage Buffer
- NaCl