TRAIL-R3 / DCR1 Antibody (aa33-63)

Primary AntibodyLSBio Guarantee

Antibody:	Goat Polyclonal
Applications:	Enzyme-Linked Immunosorbent Assay, Flow Cytometry, Immunocytochemistry, Immunohistochemistry (general), Western Blot
Reactivity:	Human
Format:	Liquid

$568.00each

Catalog Number: LS-C83942-200

Unit Size

Quantity

For bulk orders or custom formulations:

Description: DCR1 antibody LS-C83942 is an unconjugated goat polyclonal antibody to human DCR1 (TRAIL-R3) (aa33-63). Validated for ELISA, Flow, ICC, IHC and WB.
Application: ELISA, FC, ICC, IHC, WB
Reactivity: Hu
Intended Use: Research Use Only
Guarantees: This antibody carries the LSBio 100% Guarantee. ✓
Category: Antibodies > Primary Antibodies > Polyclonal Antibodies
Alternative Names: CD263 antigen | CD263 | Cytotoxic TRAIL receptor-3 | Decoy receptor 1 | DCR1 | DCR1-TNFR | LIT | Lymphocyte inhibitor of TRAIL | TRAIL-R3 | TRAILR3 | TRAIL receptor 3 | TRID | TNFRSF10C
Recommended Dilution: ELISA: 1:150000
UniProt Number: O14798
NCBI GenBank: NM_003841 | NP_003832.2
SwissProt: O14798

Target: Human TRAIL-R3 / DCR1
Antigen Species: Human
Epitope: This antibody recognizes human TRAIL-3 receptor and may cross-react with mouse TRAIL-R3 as Western blotting shows a similar size protein of ~33 kD from mouse spleen. TRAIL-R2 peptide from the same region does not bind to this antibody. For TRAIL-R1 there is low sequence homology in this region. This antibody may bind to TRAIL-R4.
Gene Name: TNFRSF10C

Immunogen: Synthetic peptide EVPQQTVAPQQQRHSFKGEECPAGSHRSEHTC aa 33-63, corresponding to the extracellular domain sequence of human TRAIL-R3 (DcR1). Percent identity by BLAST analysis: Human, Gorilla (100%); Orangutan (87%); Marmoset (84%).
Immunogen Type: Synthetic Peptide (Linear)

Request SDS/MSDS

To request an SDS/MSDS form for this product, please contact our Technical Support department at: technical@vectorlabs.com.