Western blot analysis of TPP1 expression in HELA whole cell lysates (lane 1). TPP1 at 61 kD, 39 kD was detected using rabbit anti- TPP1 Antigen Affinity purified polyclonal antibody at 0.5 ug/mL. The blot was developed using chemiluminescence (ECL) method.
TPP1 / CLN2 Antibody (aa227-261)
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Immunohistochemistry (general), Immunohistochemistry, Paraffin, Western Blot |
| Reactivity: | Human |
| Format: | Lyophilized |
$480.00each
Catalog Number: LS-C408111-100
Catalog Number: LS-C408111
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- CLN2 antibody LS-C408111 is an unconjugated rabbit polyclonal antibody to human CLN2 (TPP1) (aa227-261). Validated for IHC and WB.
- Application
- IHC, IHC-P, WB
- Reactivity
- Hu
- Intended Use
- Research Use Only
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- CLN2 | GIG1 | LPIC | LINCL | TPP-I | Tripeptidyl aminopeptidase | Tripeptidyl peptidase I | TPP1 | Tripeptidyl-peptidase 1 | Tripeptidyl-peptidase I | TPP-1 | Growth-inhibiting protein 1
- UniProt Number
- O14773
- NCBI GenBank
- NM_000391 | NP_000382.3
- SwissProt
- O14773
Target
- Target
- Human TPP1 / CLN2
- Antigen Species
- Human
- Epitope
- Detected in all tissues examined with highest levels in heart and placenta and relatively similar levels in other tissues.
- Gene Name
- TPP1
Antibody
- Host Species
- Rabbit
- Clonality
- Polyclonal
Immunogen
- Immunogen
- A synthetic peptide corresponding to a sequence in the middle region of human TPP1 (227-261 aa CAQFLEQYFHDSDLAQFMRLFGGNFAHQASVARVV), different from the related mouse sequence by six amino acids, and from the related rat sequence by five amino acids.
- Immunogen Type
- Synthetic Peptide (Linear)
Format
- Conjugate/Label
- Unconjugated
- Format
- Lyophilized
- Formulation
- Lyophilized from 0.2mg Na2HPO4, 5mg BSA, 0.9mg NaCl, 0.05mg sodium azide.
- Preservative
- Yes
- Purification Method
- Affinity Purified
Storage & Handling
- Storage Conditions
- At -20°C for 1 year. After reconstitution, at 4°C for 1 month. It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid freeze-thaw cycles.
- Recommended Storage Buffer
- NaCl