
Immunofluorescence analysis of HeLa cells using TP53 antibody.
TP53 / p53 Antibody
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Immunofluorescence, Immunohistochemistry (general), Western Blot |
| Reactivity: | Human, Mouse |
| Format: | Liquid |
$281.00each
Catalog Number: LS-C746919-20
Catalog Number: LS-C746919
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- P53 antibody LS-C746919 is an unconjugated rabbit polyclonal antibody to p53 (TP53) from mouse. It is reactive with human and mouse. Validated for IF, IHC and WB.
- Application
- IF, IHC, WB
- Reactivity
- Hu, Ms
- Intended Use
- Research Use Only
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- BCC7 | Cellular tumor antigen p53 | p53 | TRP53 | TP53 | p53 tumor suppressor | Phosphoprotein p53 | Antigen NY-CO-13 | Tumor protein p53 | Tumor suppressor p53 | LFS1
- Recommended Dilution: IF/ICC
- 1:50 - 1:100
- Recommended Dilution: IHC
- 1:50 - 1:200
- Recommended Dilution: WB
- 1:500 - 1:2000
- UniProt Number
- P04637
- NCBI GenBank
- NM_000546 | NP_000537.3
- SwissProt
- P04637
Target
- Target
- Mouse TP53 / p53
- Antigen Species
- Mouse
- Gene Name
- TP53
Antibody
- Host Species
- Rabbit
- Clonality
- Polyclonal
- Isotype
- IgG
- Origin Species
- Human
Immunogen
- Immunogen
- A synthetic peptide corresponding to a sequence within amino acids 300 to the C-Terminus of mouse TP53 (NP_035770.2). SAKRALPTCTSASPPQKKKPLDGEYFTLKIRGRKRFEMFRELNEALELKDAHATEESGDSRAHSSYLKTKKGQSTSRHKKTMVKKVGPDSD
- Immunogen Type
- Synthetic Peptide (Linear)
Format
- Conjugate/Label
- Unconjugated
- Format
- Liquid
- Formulation
- PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
- Volume
- 20 Microliter
- Preservative
- Yes
- Purification Method
- Affinity Purified
Storage & Handling
- Storage Conditions
- Store at -20°C. Avoid freeze-thaw cycles.
- Recommended Storage Buffer
- PBS
