Western blot analysis of extracts of TEP1 cells.
TP1 / TEP1 Antibody
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Western Blot |
| Reactivity: | Human |
| Format: | Liquid |
$281.00each
Catalog Number: LS-C411365-20
Catalog Number: LS-C411365
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- TEP1 antibody LS-C411365 is an unconjugated rabbit polyclonal antibody to human TEP1 (TP1). Validated for WB.
- Application
- WB
- Reactivity
- Hu
- Intended Use
- Research Use Only
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- p80 telomerase homolog | TEP1 | Telomerase protein 1 | TLP1 | TROVE domain family, member 1 | TROVE1 | VAULT2 | p240 | Telomerase protein component 1 | TP1
- Recommended Dilution: WB
- 1:500 - 1:2000
- UniProt Number
- Q99973
- NCBI GenBank
- NM_007110 | NP_009041.2
- SwissProt
- Q99973
Target
- Target
- Human TP1 / TEP1
- Antigen Species
- Human
- Epitope
- Human TP1 / TEP1
- Gene Name
- TEP1
Antibody
- Host Species
- Rabbit
- Clonality
- Polyclonal
- Isotype
- IgG
Immunogen
- Immunogen
- Recombinant fusion protein containing a sequence corresponding to amino acids 2523-2627 of human TEP1 (NP_009041.2). TCRESDASMDSDASMDSEPTPHLKTRQRRKIHSGSVTALHVLPELLVTASKDRDVKLWERPSMQLLGLFRCEGSVSCLEPWLGANSTLQLAVGDVQGNVYFLNWE
- Immunogen Type
- Fusion Protein (e.g., GST, MBP tag)
Format
- Conjugate/Label
- Unconjugated
- Format
- Liquid
- Formulation
- PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
- Volume
- 20 Microliter
- Preservative
- Yes
- Purification Method
- Affinity Purified
Storage & Handling
- Storage Conditions
- Store at -20°C. Avoid freeze-thaw cycles.
- Recommended Storage Buffer
- PBS