Western blot analysis of extracts of various cell lines.
TOMM40 / TOM40 Antibody
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Western Blot |
| Reactivity: | Human, Mouse, Rat |
| Format: | Liquid |
$281.00each
Catalog Number: LS-C332428-20
Catalog Number: LS-C332428
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- TOM40 antibody LS-C332428 is an unconjugated rabbit polyclonal antibody to TOM40 (TOMM40) from human. It is reactive with human, mouse and rat. Validated for WB.
- Application
- WB
- Reactivity
- Hu, Ms, Rt
- Intended Use
- Research Use Only
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- C19orf1 | p38.5 | PEREC1 | PER-EC1 | TOMM40 | D19S1177E | Protein Haymaker | TOM40
- Recommended Dilution: WB
- 1:500 - 1:2000
- UniProt Number
- O96008
- NCBI GenBank
- NM_006114 | NP_006105.1
- SwissProt
- O96008
Target
- Target
- Human TOMM40 / TOM40
- Antigen Species
- Human
- Epitope
- Human TOMM40 / TOM40
- Gene Name
- TOMM40
Antibody
- Host Species
- Rabbit
- Clonality
- Polyclonal
- Isotype
- IgG
Immunogen
- Immunogen
- Recombinant fusion protein containing a sequence corresponding to amino acids 1-90 of human TOMM40 (NP_001122389.1). MGNVLAASSPPAGPPPPPAPALVGLPPPPPSPPGFTLPPLGGSLGAGTSTSRSSERTPGAATASASGAAEDGACGCLPNPGTFEECHRKC
- Immunogen Type
- Fusion Protein (e.g., GST, MBP tag)
Format
- Conjugate/Label
- Unconjugated
- Format
- Liquid
- Formulation
- PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
- Volume
- 20 Microliter
- Preservative
- Yes
- Purification Method
- Affinity Purified
Storage & Handling
- Storage Conditions
- Store at -20°C. Avoid freeze-thaw cycles.
- Recommended Storage Buffer
- PBS