
TNPO1 / Transportin 1 Antibody
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Western Blot |
| Reactivity: | Human, Mouse, Rat |
| Format: | Liquid |
$281.00each
Catalog Number: LS-C410970-20
Catalog Number: LS-C410970
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- Transportin 1 antibody LS-C410970 is an unconjugated rabbit polyclonal antibody to Transportin 1 (TNPO1) from human. It is reactive with human, mouse and rat. Validated for WB.
- Application
- WB
- Reactivity
- Hu, Ms, Rt
- Intended Use
- Research Use Only
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- Importin beta 2 | Karyopherin (importin) beta 2 | Importin 2 | Karyopherin beta-2 | KPNB2 | TRN | Transportin 1 | Transportin-1 | Importin beta-2 | Importin beta-2 subunit | IPO2 | M9 region interaction protein | Mip1 | TNPO1
- Recommended Dilution: WB
- 1:200 - 1:1000
- UniProt Number
- Q92973
- NCBI GenBank
- NM_002270 | NP_002261.3
- SwissProt
- Q92973
Target
- Target
- Human TNPO1 / Transportin 1
- Antigen Species
- Human
- Epitope
- Human TNPO1 / Transportin 1
- Gene Name
- TNPO1
Antibody
- Host Species
- Rabbit
- Clonality
- Polyclonal
- Isotype
- IgG
Immunogen
- Immunogen
- A synthetic peptide corresponding to a sequence within amino acids 800 to the C-Terminus of human TNPO1 (NP_002261.3). QFIRPWCTSLRNIRDNEEKDSAFRGICTMISVNPSGVIQDFIFFCDAVASWINPKDDLRDMFCKILHGFKNQVGDENWRRFSDQFPLPLKERLAAFYGV
- Immunogen Type
- Synthetic Peptide (Linear)
Format
- Conjugate/Label
- Unconjugated
- Format
- Liquid
- Formulation
- PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
- Volume
- 20 Microliter
- Preservative
- Yes
- Purification Method
- Affinity Purified
Storage & Handling
- Storage Conditions
- Store at -20°C. Avoid freeze-thaw cycles.
- Recommended Storage Buffer
- PBS
