Western blot testing of 1) rat brain and 2) human HeLa lysate with TSG6 antibody at 0.5ug/ml. Predicted molecular weight ~31 kDa.
TNFAIP6 / TSG-6 Antibody
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Western Blot |
| Reactivity: | Human, Rat |
| Format: | Lyophilized |
$587.00each
Catalog Number: LS-C783008-100
Catalog Number: LS-C783008
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- TSG-6 antibody LS-C783008 is an unconjugated rabbit polyclonal antibody to TSG-6 (TNFAIP6) from human. It is reactive with human and rat. Validated for WB.
- Application
- WB
- Reactivity
- Hu, Rt
- Intended Use
- Research Use Only
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- Hyaluronate-binding protein | TNF-stimulated gene 6 protein | TSG-6 | TNF alpha-induced protein 6 | TNFAIP6 | TSG6
- Recommended Dilution: WB
- 0.5 - 1 µg/ml
- UniProt Number
- P98066
- NCBI GenBank
- NM_007115 | NP_009046.2
- SwissProt
- P98066
Target
- Target
- Human TNFAIP6 / TSG-6
- Antigen Species
- Human
- Gene Name
- TNFAIP6
Antibody
- Host Species
- Rabbit
- Clonality
- Polyclonal
- Isotype
- IgG
- Origin Species
- Human
Immunogen
- Immunogen
- Amino acids 46-91 (KYKLTYAEAKAVCEFEGGHLATYKQLEAARKIGFHVCAAGWMAKGR) from the human protein were used as the immunogen for the TSG6 antibody.
Format
- Conjugate/Label
- Unconjugated
- Format
- Lyophilized
- Formulation
- Lyophilized from PBS, 2.5% BSA, 0.025% sodium azide.
- Preservative
- Yes
- Purification Method
- Affinity Purified
Storage & Handling
- Storage Conditions
- After reconstitution, store at 4°C for up to 1 month. Long-term: aliquot and store at -20°C. Avoid freeze-thaws cycles.
- Recommended Storage Buffer
- PBS