Immunofluorescence analysis of HeLa cells.

TMSB4X / Thymosin Beta-4 Antibody

Primary AntibodyLSBio Guarantee

Antibody:	Rabbit Polyclonal
Applications:	Immunofluorescence, Immunohistochemistry (general), Western Blot
Reactivity:	Human, Mouse, Rat
Format:	Liquid

$281.00each

Catalog Number: LS-C346082-20

Unit Size

Quantity

For bulk orders or custom formulations:

Description: Thymosin Beta-4 antibody LS-C346082 is an unconjugated rabbit polyclonal antibody to Thymosin Beta-4 (TMSB4X) from human. It is reactive with human, mouse and rat. Validated for IF, IHC and WB.
Application: IF, IHC, WB
Reactivity: Hu, Ms, Rt
Intended Use: Research Use Only
Guarantees: This antibody carries the LSBio 100% Guarantee. ✓
Category: Antibodies > Primary Antibodies > Polyclonal Antibodies
Alternative Names: FX | Thymosin beta-4 | Thymosin, beta 4, X chromosome | TMSB4 | TMSB4X | Prothymosin beta-4 | TB4X | THYB4 | Thymosin beta 4, X-linked | PTMB4 | T beta-4
Recommended Dilution: IF/ICC: 1:50 - 1:100
Recommended Dilution: IHC: 1:50 - 1:200
Recommended Dilution: WB: 1:500 - 1:2000
UniProt Number: P62328
NCBI GenBank: NM_021109 | NP_066932.1
SwissProt: P62328

Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-44 of human TMSB4X (NP_066932.1). MSDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES
Immunogen Type: Fusion Protein (e.g., GST, MBP tag)

Request SDS/MSDS

To request an SDS/MSDS form for this product, please contact our Technical Support department at: technical@vectorlabs.com.