Western blot analysis of extracts of HeLa cells, using TMEM70 antibody at 1:3000 dilution. The secondary antibody used was an HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates were loaded 25ug per lane and 3% nonfat dry milk in TBST was used for blocking. An ECL Kit was used for detection and the exposure time was 90s.

TMEM70 Antibody

Primary AntibodyLSBio Guarantee

Antibody:	Rabbit Polyclonal
Applications:	Western Blot
Reactivity:	Human, Mouse
Format:	Liquid

$281.00each

Catalog Number: LS-C748749-20

Unit Size

Quantity

For bulk orders or custom formulations:

Overview

Description: TMEM70 antibody LS-C748749 is an unconjugated rabbit polyclonal antibody to TMEM70 from human. It is reactive with human and mouse. Validated for WB.
Application: WB
Reactivity: Hu, Ms
Intended Use: Research Use Only
Guarantees: This antibody carries the LSBio 100% Guarantee. ✓
Category: Antibodies > Primary Antibodies > Polyclonal Antibodies
Alternative Names: MC5DN2 | TMEM70 | Transmembrane protein 70
Recommended Dilution: WB: 1:500 - 1:2000
UniProt Number: Q9BUB7
NCBI GenBank: NM_017866 | NP_060336.3
SwissProt: Q9BUB7

Target

Target: Human TMEM70
Antigen Species: Human
Gene Name: TMEM70

Antibody

Host Species: Rabbit
Clonality: Polyclonal
Isotype: IgG
Origin Species: Human

Immunogen

Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 161-260 of human TMEM70 (NP_060336.3). FITKGYVIRLYHEATTDTYKAITYNAMLAETSTVFHQNDVKIPDAKHVFTTFYAKTKSLLVNPVLFPNREDYIHLMGYDKEEFILYMEETSEEKRHKDDK
Immunogen Type: Fusion Protein (e.g., GST, MBP tag)