Western blot analysis of extracts of mouse kidney, using VMP1 antibody at 1:1000 dilution. The secondary antibody used was an HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates were loaded 25ug per lane and 3% nonfat dry milk in TBST was used for blocking. An ECL Kit was used for detection and the exposure time was 5s.

TMEM49 Antibody

Primary AntibodyLSBio Guarantee

Antibody:	Rabbit Polyclonal
Applications:	Western Blot
Reactivity:	Human, Mouse
Format:	Liquid

$281.00each

Catalog Number: LS-C750493-20

Unit Size

Quantity

For bulk orders or custom formulations:

Overview

Description: TMEM49 antibody LS-C750493 is an unconjugated rabbit polyclonal antibody to TMEM49 from human. It is reactive with human and mouse. Validated for WB.
Application: WB
Reactivity: Hu, Ms
Intended Use: Research Use Only
Guarantees: This antibody carries the LSBio 100% Guarantee. ✓
Category: Antibodies > Primary Antibodies > Polyclonal Antibodies
Alternative Names: TMEM49 | VMP1 | TANGO5 | Transmembrane protein 49 | EPG3 | TDC1 | Vacuole membrane protein 1
Recommended Dilution: WB: 1:200 - 1:2000
UniProt Number: Q96GC9
NCBI GenBank: NM_030938 | NP_112200.2
SwissProt: Q96GC9

Target

Target: Human TMEM49
Antigen Species: Human
Gene Name: VMP1

Antibody

Host Species: Rabbit
Clonality: Polyclonal
Isotype: IgG
Origin Species: Human

Immunogen

Immunogen: A synthetic peptide corresponding to a sequence within amino acids 300 to the C-Terminus of human VMP1 (NP_112200.2). KMHIQKIFVIITFSKHIVEQMVAFIGAVPGIGPSLQKPFQEYLEAQRQKLHHKSEMGTPQGENWLSWMFEKLVVVMVCYFILSIINSMAQSYAKRIQQRLNSEEKTK
Immunogen Type: Synthetic Peptide (Linear)