TMEM173 antibody Western blot. All lanes: Anti TMEM173 at 0.5 ug/ml. Lane 1: A549 Whole Cell Lysate at 40 ug. Lane 2: HELA Whole Cell Lysate at 40 ug. Predicted band size: 42 kD. Observed band size: 42 kD.
TMEM173 / STING Antibody (aa284-316)
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Immunohistochemistry (general), Immunohistochemistry, Paraffin, Western Blot |
| Reactivity: | Human |
| Format: | Lyophilized |
$480.00each
Catalog Number: LS-C407725-100
Catalog Number: LS-C407725
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- STING antibody LS-C407725 is an unconjugated rabbit polyclonal antibody to human STING (TMEM173) (aa284-316). Validated for IHC and WB.
- Application
- IHC, IHC-P, WB
- Reactivity
- Hu
- Intended Use
- Research Use Only
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- ERIS | MITA | HSTING | Transmembrane protein 173 | TMEM173 | HMITA | Mediator of IRF3 activation | MPYS | NET23 | STING
- UniProt Number
- Q86WV6
- SwissProt
- Q86WV6
Target
- Target
- Human TMEM173 / STING
- Antigen Species
- Human
- Epitope
- Ubiquitously expressed. Expressed in skin endothelial cells, alveolar type 2 pneumocytes, bronchial epithelium and alveolar macrophages. .
- Gene Name
- STING1
Antibody
- Host Species
- Rabbit
- Clonality
- Polyclonal
Immunogen
- Immunogen
- A synthetic peptide corresponding to a sequence at the C-Terminus of human TMEM173 (284-316 aa RLEQAKLFCRTLEDILADAPESQNNCRLIAYQE), different from the related mouse sequence by five amino acids.
- Immunogen Type
- Synthetic Peptide (Linear)
Format
- Conjugate/Label
- Unconjugated
- Format
- Lyophilized
- Formulation
- Lyophilized from 0.2mg Na2HPO4, 5mg BSA, 0.9mg NaCl, 0.05mg sodium azide.
- Preservative
- Yes
- Purification Method
- Affinity Purified
Storage & Handling
- Storage Conditions
- At -20°C for 1 year. After reconstitution, at 4°C for 1 month. It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid freeze-thaw cycles.
- Recommended Storage Buffer
- NaCl