TLR5 Antibody (aa151-181)

Primary AntibodyLSBio Guarantee

Antibody:	Goat Polyclonal
Applications:	Enzyme-Linked Immunosorbent Assay, Flow Cytometry, Immunocytochemistry, Immunohistochemistry (general), Western Blot
Reactivity:	Human
Format:	Liquid

$568.00each

Catalog Number: LS-C83963-200

Unit Size

Quantity

For bulk orders or custom formulations:

Description: TLR5 antibody LS-C83963 is an unconjugated goat polyclonal antibody to human TLR5 (aa151-181). Validated for ELISA, Flow, ICC, IHC and WB.
Application: ELISA, FC, ICC, IHC, WB
Reactivity: Hu
Predicted Reactivity: Non-Human Primate
Intended Use: Research Use Only
Guarantees: This antibody carries the LSBio 100% Guarantee. ✓
Category: Antibodies > Primary Antibodies > Polyclonal Antibodies
Alternative Names: TIL3 | TLR5 | Toll-like receptor 5 | SLEB1
Recommended Dilution: ELISA: 1:35000
Recommended Dilution: FC: 1:50
Recommended Dilution: IF/ICC: 1:250
Recommended Dilution: IHC: 1:125
Recommended Dilution: WB: 1:100
UniProt Number: O60602
NCBI GenBank: BAB43955.1 | NM_003268
SwissProt: O60602

Target: Human TLR5
Antigen Species: Human
Epitope: Peptide sequence is <50 % identical to other human TLR receptors in this region. The antibody recognizes human TLR5 and was not tested for cross-reactivity to mouse TLR5.
Gene Name: TLR5

Immunogen: Synthetic peptide DLSKNQIRSLYLHPSFGKLNSLKSIDFSSNQ corresponding to aa 151-181 of human TLR5. Percent identity by BLAST analysis: Human, Chimpanzee, Gorilla, Orangutan, Gibbon, Macaque, Monkey, Spider monkey, Siamang (100%); Colobus monkey, Baboon (97%); Marmoset (94%); Sheep, Goat, Panda, Water buffalo (84%); Zebu, Bovine (81%).
Immunogen Type: Synthetic Peptide (Linear)