IHC of TLR10 antibody. Human spleen.

TLR10 Antibody (aa81-111)

Primary AntibodyLSBio Guarantee

Antibody:	Goat Polyclonal
Applications:	Immunocytochemistry, Immunohistochemistry (general), Western Blot
Reactivity:	Human
Format:	Liquid

$568.00each

Catalog Number: LS-C83991-200

Unit Size

Quantity

For bulk orders or custom formulations:

Description: TLR10 antibody LS-C83991 is an unconjugated goat polyclonal antibody to human TLR10 (aa81-111). Validated for ICC, IHC and WB.
Application: ICC, IHC, WB
Reactivity: Hu
Predicted Reactivity: Non-Human Primate
Intended Use: Research Use Only
Guarantees: This antibody carries the LSBio 100% Guarantee. ✓
Category: Antibodies > Primary Antibodies > Polyclonal Antibodies
Alternative Names: CD290 | CD290 antigen | Toll-like receptor 10 | TLR10
Recommended Dilution: IF/ICC: 1:200
UniProt Number: Q9BXR5
NCBI GenBank: NM_030956 | NP_112218.2
SwissProt: Q9BXR5

Target: Human TLR10
Antigen Species: Human
Epitope: Peptide sequence is <50 % identical to other human TLR receptors in this region. The antibody recognizes human TLR10.
Gene Name: TLR10

Immunogen: 31 AA (aa) synthetic peptide C-HNRIQQLDLKTFEFNKELRYLDLSNNRLKSV corresponding to aa 81-111 of the N-Terminus domain of Human TLR10. Percent identity by BLAST analysis: Human, Chimpanzee, Gorilla, Gibbon (100%); Orangutan, Monkey (97%); Marmoset (94%); Sheep, Goat, Zebu, Bovine (87%); Elephant, Horse (84%); Panda, Pig (81%).
Immunogen Type: Synthetic Peptide (Linear)