
Western blot analysis of Thrombospondin 2 using anti-Thrombospondin 2 antibody. Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel) / 90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 50ug of sample under reducing conditions. Lane 1: rat brain tissue lysates, Lane 2: mouse brain tissue lysates. After Electrophoresis, proteins were transferred to a Nitrocellulose membrane at 150mA for 50-90 minutes. Blocked the membrane with 5% Non-fat Milk/ TBS for 1.5 hour at RT. The membrane was incubated with rabbit anti-Thrombospondin 2 antigen affinity purified polyclonal antibody at 0.5 ?g/mL overnight at 4?C, then washed with TBS-0.1% Tween 3 times with 5 minutes each and probed with a goat anti-rabbit IgG-HRP secondary antibody at a dilution of 1:10000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit with Tanon 5200 system. A specific band was detected for Thrombospondin 2 at approximately 160KD. The expected band size for Thrombospondin 2 is at 130KD.
THBS2 / Thrombospondin 2 Antibody
| Antibody: | Rabbit Polyclonal |
| Applications: | Western Blot |
| Reactivity: | Human, Mouse, Rat |
| Format: | Lyophilized |
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- Thrombospondin 2 antibody LS-C756574 is an unconjugated rabbit polyclonal antibody to Thrombospondin 2 (THBS2) from human. It is reactive with human, mouse and rat. Validated for WB.
- Application
- WB
- Reactivity
- Hu, Ms, Rt
- Intended Use
- Research Use Only
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- Thrombospondin 2 | TSP2 | THBS2 | Thrombospondin-2
- Recommended Dilution: WB
- 0.1 - 0.5 µg/ml
- UniProt Number
- P35442
- NCBI GenBank
- NM_003247 | NP_003238.2
- SwissProt
- P35442
Target
- Target
- Human THBS2 / Thrombospondin 2
- Antigen Species
- Human
- Epitope
- No cross reactivity with other proteins.
- Gene Name
- THBS2
Antibody
- Host Species
- Rabbit
- Clonality
- Polyclonal
- Isotype
- IgG
- Origin Species
- Human
Immunogen
- Immunogen
- A synthetic peptide corresponding to a sequence of human Thrombospondin 2 (DHVKDTSFDLFSISNINRKTIGAKQFRGPD).
- Immunogen Type
- Synthetic Peptide (Linear)
Format
- Conjugate/Label
- Unconjugated
- Format
- Lyophilized
- Formulation
- Lyophilized from 0.2mg Na2HPO4, 0.9mg NaCl, 0.05mg sodium azide, 4mg Trehalose
- Preservative
- Yes
- Purification Method
- Affinity Purified
Storage & Handling
- Storage Conditions
- After reconstitution, may be stored at 4°C for 1 month. For long-term storage and to avoid freeze-thaw cycles, aliquot and store at -20°C.
- Recommended Storage Buffer
- NaCl
