TH antibody Western blot. All lanes: Anti TH at 0.5 ug/ml. Lane 1: Rat Brain Tissue Lysate at 50 ug. Lane 2: Mouse Brain Tissue Lysate at 50 ug. Predicted band size: 59 kD. Observed band size: 59 kD.
TH / Tyrosine Hydroxylase Antibody (aa193-222)
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Immunohistochemistry (general), Immunohistochemistry, Paraffin, Western Blot |
| Reactivity: | Hamster, Human, Mouse, Rat |
| Format: | Lyophilized |
$480.00each
Catalog Number: LS-C407661-100
Catalog Number: LS-C407661
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- Tyrosine Hydroxylase antibody LS-C407661 is an unconjugated rabbit polyclonal antibody to Tyrosine Hydroxylase (TH) (aa193-222) from human. It is reactive with human, mouse, rat and other species. Validated for IHC and WB.
- Application
- IHC, IHC-P, WB
- Reactivity
- Ham, Hu, Ms, Rt
- Intended Use
- Research Use Only
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- DYT14 | Dystonia 14 | TH | TYH | Tyrosine 3-hydroxylase | Tyrosine hydroxylase | DYT5b | Tyrosine 3-monooxygenase
- UniProt Number
- P07101
- NCBI GenBank
- NM_000360 | NP_000351.2
- SwissProt
- P07101
Target
- Target
- Human TH / Tyrosine Hydroxylase
- Antigen Species
- Human
- Epitope
- Mainly expressed in the brain and adrenal glands.
- Gene Name
- TH
Antibody
- Host Species
- Rabbit
- Clonality
- Polyclonal
Immunogen
- Immunogen
- A synthetic peptide corresponding to a sequence in the middle region of human Tyrosine Hydroxylase (193-222 aa KVPWFPRKVSELDKCHHLVTKFDPDLDLDH), identical to the related mouse and rat sequences.
- Immunogen Type
- Synthetic Peptide (Linear)
Format
- Conjugate/Label
- Unconjugated
- Format
- Lyophilized
- Formulation
- Lyophilized from 0.2mg Na2HPO4, 5mg BSA, 0.9mg NaCl, 0.05mg sodium azide.
- Preservative
- Yes
- Purification Method
- Affinity Purified
Storage & Handling
- Storage Conditions
- At -20°C for 1 year. After reconstitution, at 4°C for 1 month. It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid freeze-thaw cycles.
- Recommended Storage Buffer
- NaCl