Western blot - Anti-TGFBR1/Tgf Beta Receptor I Picoband Antibody
TGFBR1 / ALK5 Antibody
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Western Blot |
| Reactivity: | Human |
| Format: | Lyophilized |
$480.00each
Catalog Number: LS-C662381-100
Catalog Number: LS-C662381
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- ALK5 antibody LS-C662381 is an unconjugated rabbit polyclonal antibody to human ALK5 (TGFBR1). Validated for WB.
- Application
- WB
- Reactivity
- Hu
- Intended Use
- Research Use Only
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- AAT5 | ACVRLK4 | ALK-5 | ALK5 | Activin receptor-like kinase 5 | LDS1A | LDS2A | MSSE | SKR4 | TGF beta receptor I | TGF-beta receptor type-1 | TGF-beta type I receptor | TbetaR-I | TGFR-1 | TGF-beta receptor type I | TGFBR1
- UniProt Number
- P36897
- NCBI GenBank
- NM_004612 | NP_004603.1
- SwissProt
- P36897
Target
- Target
- Human TGFBR1 / ALK5
- Antigen Species
- Human
- Epitope
- Found in all tissues examined, most abundant in placenta and least abundant in brain and heart.
- Gene Name
- TGFBR1
Antibody
- Host Species
- Rabbit
- Clonality
- Polyclonal
Immunogen
- Immunogen
- A synthetic peptide corresponding to a sequence at the N-Terminus of human TGFBR1 (149-186 aa HNRTVIHHRVPNEEDPSLDRPFISEGTTLKDLIYDMTT), identical to the related mouse and rat sequences.
- Immunogen Type
- Synthetic Peptide (Linear)
Format
- Conjugate/Label
- Unconjugated
- Format
- Lyophilized
- Formulation
- Lyophilized from 0.2mg Na2HPO4, 5mg BSA, 0.9mg NaCl, 0.05mg sodium azide.
- Preservative
- Yes
- Purification Method
- Affinity Purified
Storage & Handling
- Storage Conditions
- At -20°C for 1 year. After reconstitution, at 4°C for 1 month. It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid freeze-thaw cycles.
- Recommended Storage Buffer
- NaCl