Transferrin antibody Western blot. All lanes: Anti Transferrin at 0.5 ug/ml. Lane 1: Rat Thymus Tissue Lysate at 50 ug. Lane 2: Human Placenta Tissue Lysate at 50 ug. Predicted band size: 77 kD. Observed band size: 77 kD.
TF / Transferrin Antibody (aa20-49)
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Immunohistochemistry (general), Immunohistochemistry, Paraffin, Western Blot |
| Reactivity: | Human, Mouse, Rat |
| Format: | Lyophilized |
$480.00each
Catalog Number: LS-C408039-100
Catalog Number: LS-C408039
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- Transferrin antibody LS-C408039 is an unconjugated rabbit polyclonal antibody to Transferrin (TF) (aa20-49) from human. It is reactive with human, mouse and rat. Validated for IHC and WB.
- Application
- IHC, IHC-P, WB
- Reactivity
- Hu, Ms, Rt
- Intended Use
- Research Use Only
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- PRO1557 | Serotransferrin | Siderophilin | TF | TFQTL1 | Beta-1 metal-binding globulin | Transferrin | PRO2086
- UniProt Number
- P02787
- NCBI GenBank
- NM_001063 | NP_001054.1
- SwissProt
- P02787
Target
- Target
- Human TF / Transferrin
- Antigen Species
- Human
- Epitope
- Expressed by the liver and secreted in plasma.
- Gene Name
- TF
Antibody
- Host Species
- Rabbit
- Clonality
- Polyclonal
Immunogen
- Immunogen
- A synthetic peptide corresponding to a sequence at the N-Terminus of human Transferrin (20-49 aa VPDKTVRWCAVSEHEATKCQSFRDHMKSVI), different from the related mouse and rat sequences by five amino acids.
- Immunogen Type
- Synthetic Peptide (Linear)
Format
- Conjugate/Label
- Unconjugated
- Format
- Lyophilized
- Formulation
- Lyophilized from 0.2mg Na2HPO4, 0.9mg NaCl, 0.05mg sodium azide, 4mg Trehalose
- Preservative
- Yes
- Purification Method
- Affinity Purified
Storage & Handling
- Storage Conditions
- At -20°C for 1 year. After reconstitution, at 4°C for 1 month. It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid freeze-thaw cycles.
- Recommended Storage Buffer
- NaCl