Western blot testing of human 1) HeLa, 2) MCF7, 3) COLO320, 4) HepG2, 5) rat stomach, 6) mouse stomach and 7) mouse heart lysate with Tec antibody at 0.5ug/ml. Predicted molecular weight ~73 kDa.

TEC Antibody

Primary AntibodyLSBio Guarantee

Antibody:	Rabbit Polyclonal
Applications:	Western Blot
Reactivity:	Human, Mouse, Rat
Format:	Lyophilized

$587.00each

Catalog Number: LS-C782060-100

Unit Size

Quantity

For bulk orders or custom formulations:

Overview

Description: TEC antibody LS-C782060 is an unconjugated rabbit polyclonal antibody to TEC from human. It is reactive with human, mouse and rat. Validated for WB.
Application: WB
Reactivity: Hu, Ms, Rt
Intended Use: Research Use Only
Guarantees: This antibody carries the LSBio 100% Guarantee. ✓
Category: Antibodies > Primary Antibodies > Polyclonal Antibodies
Alternative Names: TEC | Tyrosine-protein kinase Tec | PSCTK4 | Tec family | Tec protein tyrosine kinase
Recommended Dilution: WB: 0.5 - 1 µg/ml
UniProt Number: P42680
NCBI GenBank: NM_003215 | NP_003206.2
SwissProt: P42680

Target

Target: Human TEC
Antigen Species: Human
Gene Name: TEC

Antibody

Host Species: Rabbit
Clonality: Polyclonal
Isotype: IgG
Origin Species: Human

Immunogen

Immunogen: Amino acids HDANTLYIFAPSPQSRDLWVKKLKEEIKNNNNIMIKYHPK from the human protein were used as the immunogen for the Tec antibody.

Format

Conjugate/Label: Unconjugated
Format: Lyophilized
Formulation: Lyophilized from PBS, 2% Trehalose, 0.025% sodium azide
Preservative: Yes
Purification Method: Affinity Purified

Storage & Handling

Storage Conditions: After reconstitution, store at 4°C for up to 1 month. Long-term: aliquot and store at -20°C. Avoid freeze-thaws cycles.
Recommended Storage Buffer: PBS