TAP2 antibody Western blot. All lanes: Anti TAP2 at 0.5 ug/ml. WB: HELA Whole Cell Lysate at 40 ug. Predicted band size: 87 kD. Observed band size: 87 kD.

TAP2 Antibody (aa611-651)

Primary AntibodyLSBio Guarantee

Antibody:	Rabbit Polyclonal
Applications:	Western Blot
Reactivity:	Human
Format:	Lyophilized

$480.00each

Catalog Number: LS-C408036-100

Unit Size

Quantity

For bulk orders or custom formulations:

Overview

Description: TAP2 antibody LS-C408036 is an unconjugated rabbit polyclonal antibody to human TAP2 (aa611-651). Validated for WB.
Application: WB
Reactivity: Hu
Intended Use: Research Use Only
Guarantees: This antibody carries the LSBio 100% Guarantee. ✓
Category: Antibodies > Primary Antibodies > Polyclonal Antibodies
Alternative Names: ABC transporter, MHC 2 | ABCB3 | APT2 | Antigen peptide transporter 2 | D6S217E | ABC18 | Ham2 | Peptide supply factor 2 | Peptide transporter PSF2 | Peptide transporter TAP2 | PSF2 | Y1 | PSF-2 | RING11 | TAP2
UniProt Number: Q03519
NCBI GenBank: NM_000544 | NP_000535.3
SwissProt: Q03519

Target

Target: Human TAP2
Antigen Species: Human
Gene Name: TAP2

Antibody

Host Species: Rabbit
Clonality: Polyclonal

Immunogen

Immunogen: A synthetic peptide corresponding to a sequence at the C-Terminus of human TAP2 (611-651 aa QKQRLAIARALVRDPRVLILDEATSALDVQCEQALQDWNSR), different from the related mouse sequence by five amino acids, and from the related rat sequence by six amino acids.
Immunogen Type: Synthetic Peptide (Linear)

Format

Conjugate/Label: Unconjugated
Format: Lyophilized
Formulation: Lyophilized from 0.2mg Na2HPO4, 5mg BSA, 0.9mg NaCl, 0.05mg sodium azide.
Preservative: Yes
Purification Method: Affinity Purified

Storage & Handling

Storage Conditions: At -20°C for 1 year. After reconstitution, at 4°C for 1 month. It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid freeze-thaw cycles.
Recommended Storage Buffer: NaCl