Western blot testing of human 1) HeLa, 2) placenta, 3) A549, 4) MDA-MB-453, 5) SW620, 6) 22RV1 and 7) SW579 with TANK antibody at 0.5ug/ml. Expected molecular weight ~48 kDa.

TANK Antibody

Primary AntibodyLSBio Guarantee

Antibody:	Rabbit Polyclonal
Applications:	Immunohistochemistry, Paraffin, Western Blot
Reactivity:	Human, Mouse, Rat
Format:	Lyophilized

$587.00each

Catalog Number: LS-C782241-100

Unit Size

Quantity

For bulk orders or custom formulations:

Overview

Description: TANK antibody LS-C782241 is an unconjugated rabbit polyclonal antibody to TANK from human. It is reactive with human, mouse and rat. Validated for IHC and WB.
Application: IHC-P, WB
Reactivity: Hu, Ms, Rt
Intended Use: Research Use Only
Guarantees: This antibody carries the LSBio 100% Guarantee. ✓
Category: Antibodies > Primary Antibodies > Polyclonal Antibodies
Alternative Names: I-TRAF | TANK | TRAF-interacting protein | ITRAF
Recommended Dilution: IHC-P: 1 - 2 µg/ml
Recommended Dilution: WB: 0.5 - 1 µg/ml
UniProt Number: Q92844
NCBI GenBank: NM_004180 | NP_004171.2
SwissProt: Q92844

Target

Target: Human TANK
Antigen Species: Human
Gene Name: TANK

Antibody

Host Species: Rabbit
Clonality: Polyclonal
Isotype: IgG
Origin Species: Human

Immunogen

Immunogen: Amino acids MDKNIGEQLNKAYEAFRQACMDRDSAVKELQQK were used as the immunogen for the TANK antibody.

Format

Conjugate/Label: Unconjugated
Format: Lyophilized
Formulation: Lyophilized from 1X PBS with 2% Trehalose and 0.025% sodium azide
Preservative: Yes
Purification Method: Affinity Purified

Storage & Handling

Storage Conditions: After reconstitution, store at 4°C for up to 1 month. Long-term: aliquot and store at -20°C. Avoid freeze-thaws cycles.
Recommended Storage Buffer: 1X PBS