TADA3 / ADA3 Antibody
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Immunohistochemistry (general), Western Blot |
| Reactivity: | Human, Mouse, Rat |
| Format: | Liquid |
$281.00each
Catalog Number: LS-C408935-20
Catalog Number: LS-C408935
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- ADA3 antibody LS-C408935 is an unconjugated rabbit polyclonal antibody to ADA3 (TADA3) from human. It is reactive with human, mouse and rat. Validated for IHC and WB.
- Application
- IHC, WB
- Reactivity
- Hu, Ms, Rt
- Intended Use
- Research Use Only
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- ADA3 homolog | ADA3 | ADA3-like protein | HADA3 | NGG1 | STAF54 | TADA3L | TADA3 | Transcriptional adapter 3-like | Transcriptional adaptor 3 | Transcriptional adapter 3
- Recommended Dilution: IHC
- 1:50 - 1:200
- Recommended Dilution: WB
- 1:500 - 1:2000
- UniProt Number
- O75528
- NCBI GenBank
- NM_006354 | NP_006345.1
- SwissProt
- O75528
Target
- Target
- Human TADA3 / ADA3
- Antigen Species
- Human
- Epitope
- Human TADA3 / ADA3
- Gene Name
- TADA3
Antibody
- Host Species
- Rabbit
- Clonality
- Polyclonal
- Isotype
- IgG
Immunogen
- Immunogen
- Recombinant fusion protein containing a sequence corresponding to amino acids 270-369 of human TADA3 (NP_597814.1). EENIISPMEDSPIPDMSGKESGADGASTSPRNQNKPFSVPHTKSLESRIKEELIAQGLLESEDRPAEDSEDEVLAELRKRQAELKALSAHNRTKKHDLLR
- Immunogen Type
- Fusion Protein (e.g., GST, MBP tag)
Format
- Conjugate/Label
- Unconjugated
- Format
- Liquid
- Formulation
- PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
- Volume
- 20 Microliter
- Preservative
- Yes
- Purification Method
- Affinity Purified
Storage & Handling
- Storage Conditions
- Store at -20°C. Avoid freeze-thaw cycles.
- Recommended Storage Buffer
- PBS