
Western blot - Anti-Synapsin I Picoband Antibody
SYN1 / Synapsin 1 Antibody
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Immunohistochemistry (general), Immunohistochemistry, Paraffin, Western Blot |
| Reactivity: | Human |
| Format: | Lyophilized |
$480.00each
Catalog Number: LS-C662380-100
Catalog Number: LS-C662380
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- Synapsin 1 antibody LS-C662380 is an unconjugated rabbit polyclonal antibody to human Synapsin 1 (SYN1). Validated for IHC and WB.
- Application
- IHC, IHC-P, WB
- Reactivity
- Hu
- Intended Use
- Research Use Only
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- Brain protein 4.1 | Synapsin | Synapsin I | Synapsin-1 | SYN1 | SYN1a | SYN1b | SYNI
- UniProt Number
- P17600
- NCBI GenBank
- NM_006950 | NP_008881.2
- SwissProt
- P17600
Target
- Target
- Human SYN1 / Synapsin 1
- Antigen Species
- Human
- Gene Name
- SYN1
Antibody
- Host Species
- Rabbit
- Clonality
- Polyclonal
Immunogen
- Immunogen
- A synthetic peptide corresponding to a sequence at the C-Terminus of human Synapsin I (662-705 aa KSQSLTNAFNLPEPAPPRPSLSQDEVKAETIRSLRKSFASL FSD), identical to the related mouse and rat sequences.
- Immunogen Type
- Synthetic Peptide (Linear)
Format
- Conjugate/Label
- Unconjugated
- Format
- Lyophilized
- Formulation
- Lyophilized from 0.2mg Na2HPO4, 5mg BSA, 0.9mg NaCl, 0.05mg sodium azide.
- Preservative
- Yes
- Purification Method
- Affinity Purified
Storage & Handling
- Storage Conditions
- At -20°C for 1 year. After reconstitution, at 4°C for 1 month. It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid freeze-thaw cycles.
- Recommended Storage Buffer
- NaCl
