Western blot analysis of extracts of various cell lines.

SUMO4 Antibody

Antibody:	Rabbit Polyclonal
Applications:	Immunofluorescence, Immunohistochemistry (general), Western Blot
Reactivity:	Human, Mouse, Rat
Format:	Liquid

$281.00each

Catalog Number: LS-C349207-20

Unit Size

Quantity

For bulk orders or custom formulations:

Description: SUMO4 antibody LS-C349207 is an unconjugated rabbit polyclonal antibody to SUMO4 from human. It is reactive with human, mouse and rat. Validated for IF, IHC and WB.
Application: IF, IHC, WB
Reactivity: Hu, Ms, Rt
Intended Use: Research Use Only
Guarantees: This antibody carries the LSBio 100% Guarantee. ✓
Category: Antibodies > Primary Antibodies > Polyclonal Antibodies
Alternative Names: DJ281H8.4 | IDDM5 | Small ubiquitin-like protein 4 | SMT3H4 | SUMO-4 | SUMO4
Recommended Dilution: IF/ICC: 1:50 - 1:200
Recommended Dilution: IHC: 1:50 - 1:200
Recommended Dilution: WB: 1:500 - 1:2000
UniProt Number: Q6EEV6
NCBI GenBank: NP_001002255.1
SwissProt: Q6EEV6

Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-95 of human SUMO4 (NP_001002255.1). MANEKPTEEVKTENNNHINLKVAGQDGSVVQFKIKRQTPLSKLMKAYCEPRGLSVKQIRFRFGGQPISGTDKPAQLEMEDEDTIDVFQQPTGGVY
Immunogen Type: Fusion Protein (e.g., GST, MBP tag)