
Western blot analysis of extracts of HeLa cells.
SUMO1 / SMT3 Antibody
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Immunofluorescence, Immunohistochemistry (general), Western Blot |
| Reactivity: | Human, Mouse, Rat |
| Format: | Liquid |
$281.00each
Catalog Number: LS-C331925-20
Catalog Number: LS-C331925
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- SMT3 antibody LS-C331925 is an unconjugated rabbit polyclonal antibody to SMT3 (SUMO1) from human. It is reactive with human, mouse and rat. Validated for IF, IHC and WB.
- Application
- IF, IHC, WB
- Reactivity
- Hu, Ms, Rt
- Intended Use
- Research Use Only
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- GAP modifying protein 1 | GMP1 | OFC10 | Sentrin | SMT3 homolog 3 | SMT3C | SMT3H3 | SUMO-1 | SUMO1 | Ubiquitin-like protein UBL1 | PIC1 | Ubiquitin-like 1 (sentrin) | UBL1 | DAP1 | GAP-modifying protein 1 | Ubiquitin-like protein SMT3C
- Recommended Dilution: IF/ICC
- 1:50 - 1:200
- Recommended Dilution: IHC
- 1:50 - 1:100
- Recommended Dilution: WB
- 1:500 - 1:2000
- UniProt Number
- P63165
- NCBI GenBank
- NM_003352 | NP_003343.1
- SwissProt
- P63165
Target
- Target
- Human SUMO1 / SMT3
- Antigen Species
- Human
- Epitope
- Human SUMO1 / SMT3
- Gene Name
- SUMO1
Antibody
- Host Species
- Rabbit
- Clonality
- Polyclonal
- Isotype
- IgG
Immunogen
- Immunogen
- Recombinant fusion protein containing a sequence corresponding to amino acids 1-101 of human SUMO1 (NP_003343.1). MSDQEAKPSTEDLGDKKEGEYIKLKVIGQDSSEIHFKVKMTTHLKKLKESYCQRQGVPMNSLRFLFEGQRIADNHTPKELGMEEEDVIEVYQEQTGGHSTV
- Immunogen Type
- Fusion Protein (e.g., GST, MBP tag)
Format
- Conjugate/Label
- Unconjugated
- Format
- Liquid
- Formulation
- PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
- Volume
- 20 Microliter
- Preservative
- Yes
- Purification Method
- Affinity Purified
Storage & Handling
- Storage Conditions
- Store at -20°C. Avoid freeze-thaw cycles.
- Recommended Storage Buffer
- PBS
