STXBP2 antibody Western blot. All lanes: Anti STXBP2 at 0.5 ug/ml. Lane 1: Rat Brain Tissue Lysate at 50 ug. Lane 2: Mouse Brain Tissue Lysate at 50 ug. Lane 3: HEPG2 Whole Cell Lysate at 40 ug. Lane 4: HELA Whole Cell Lysate at 40 ug. Predicted band size: 66 kD. Observed band size: 66 kD.

STXBP2 Antibody (aa184-215)

Primary AntibodyLSBio Guarantee

Antibody:	Rabbit Polyclonal
Applications:	Western Blot
Reactivity:	Bovine, Horse, Human, Mouse, Pig, Rabbit
Format:	Lyophilized

$480.00each

Catalog Number: LS-C408033-100

Unit Size

Quantity

For bulk orders or custom formulations:

Overview

Description: STXBP2 antibody LS-C408033 is an unconjugated rabbit polyclonal antibody to STXBP2 (aa184-215) from human. It is reactive with human, mouse, bovine and other species. Validated for WB.
Application: WB
Reactivity: Bov, Hr, Hu, Ms, Por, Rb
Intended Use: Research Use Only
Guarantees: This antibody carries the LSBio 100% Guarantee. ✓
Category: Antibodies > Primary Antibodies > Polyclonal Antibodies
Alternative Names: Hunc18b | MUNC18-2 | Protein unc-18 homolog B | STXBP2 | UNC18B | Pp10122 | Syntaxin binding protein 2 | Syntaxin-binding protein 2 | Protein unc-18 homolog 2 | Unc-18B | UNC18-2
UniProt Number: Q15833
NCBI GenBank: NM_006949 | NP_008880.2
SwissProt: Q15833

Target

Target: Human STXBP2
Antigen Species: Human
Epitope: Placenta, lung, liver, kidney and pancreas, as well as in peripheral blood lymphocytes.
Gene Name: STXBP2

Antibody

Host Species: Rabbit
Clonality: Polyclonal

Immunogen

Immunogen: A synthetic peptide corresponding to a sequence at the N-Terminus of human STXBP2 (184-215 aa QEYPAIRYRKGPEDTAQLAHAVLAKLNAFKAD), different from the related mouse and rat sequences by one amino acid.
Immunogen Type: Synthetic Peptide (Linear)

Format

Conjugate/Label: Unconjugated
Format: Lyophilized
Formulation: Lyophilized from 0.2mg Na2HPO4, 5mg BSA, 0.9mg NaCl, 0.05mg sodium azide.
Preservative: Yes
Purification Method: Affinity Purified

Storage & Handling

Storage Conditions: At -20°C for 1 year. After reconstitution, at 4°C for 1 month. It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid freeze-thaw cycles.
Recommended Storage Buffer: NaCl