Munc18-1 antibody Western blot. All lanes: Anti Munc18-1 at 0.5 ug/ml. Lane 1: Rat Brain Tissue Lysate at 50 ug. Lane 2: Mouse Brain Tissue Lysate at 50 ug. Lane 3: PANC Whole Cell Lysate at 40 ug. Lane 4: HEPG2 Whole Cell Lysate at 40 ug. Lane 5: HELA Whole Cell Lysate at 40 ug. Predicted band size: 67 kD. Observed band size: 67 kD.
STXBP1 / MUNC18-1 Antibody (aa184-216)
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Immunohistochemistry (general), Immunohistochemistry, Paraffin, Western Blot |
| Reactivity: | Bovine, Dog, Guinea Pig, Horse, Human, Mammal (Other), Mouse, Pig, Rabbit, Rat, Sheep |
| Format: | Lyophilized |
$480.00each
Catalog Number: LS-C408031-100
Catalog Number: LS-C408031
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- MUNC18-1 antibody LS-C408031 is an unconjugated rabbit polyclonal antibody to MUNC18-1 (STXBP1) (aa184-216) from human. It is reactive with human, mouse, rat and other species. Validated for IHC and WB.
- Application
- IHC, IHC-P, WB
- Reactivity
- Bov, Can, GP, Hr, Hu, Mml, Ms, Por, Rb, Rt, Sh
- Intended Use
- Research Use Only
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- EIEE4 | HUNC18 | MUNC18-1 | N-Sec1 | NSEC1 | Protein unc-18 homolog 1 | Protein unc-18 homolog A | UNC18 | Unc18-1 | p67 | RBSEC1 | Unc-18A | Munc18 | Neuronal SEC1 | STXBP1 | Syntaxin binding protein 1 | Syntaxin-binding protein 1 | UNC18A
- UniProt Number
- P61764
- NCBI GenBank
- NM_003165 | NP_003156.1
- SwissProt
- P61764
Target
- Target
- Human STXBP1 / MUNC18-1
- Antigen Species
- Human
- Epitope
- Brain and spinal cord. Highly enriched in axons.
- Gene Name
- STXBP1
Antibody
- Host Species
- Rabbit
- Clonality
- Polyclonal
Immunogen
- Immunogen
- A synthetic peptide corresponding to a sequence at the N-Terminus of human Munc18-1 (184-216 aa KEYPAVRYRGEYKDNALLAQLIQDKLDAYKADD), identical to the related mouse and rat sequences.
- Immunogen Type
- Synthetic Peptide (Linear)
Format
- Conjugate/Label
- Unconjugated
- Format
- Lyophilized
- Formulation
- Lyophilized from 0.2mg Na2HPO4, 5mg BSA, 0.9mg NaCl, 0.05mg sodium azide.
- Preservative
- Yes
- Purification Method
- Affinity Purified
Storage & Handling
- Storage Conditions
- At -20°C for 1 year. After reconstitution, at 4°C for 1 month. It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid freeze-thaw cycles.
- Recommended Storage Buffer
- NaCl