Western blot analysis of extracts of various cell lines, using STIL antibody at 1:1000 dilution. The secondary antibody used was an HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates were loaded 25ug per lane and 3% nonfat dry milk in TBST was used for blocking. An ECL Kit was used for detection and the exposure time was 10s.

STIL Antibody

Primary AntibodyLSBio Guarantee

Antibody:	Rabbit Polyclonal
Applications:	Western Blot
Reactivity:	Human
Format:	Liquid

$281.00each

Catalog Number: LS-C497056-20

Unit Size

Quantity

For bulk orders or custom formulations:

Overview

Description: STIL antibody LS-C497056 is an unconjugated rabbit polyclonal antibody to human STIL. Validated for WB.
Application: WB
Reactivity: Hu
Intended Use: Research Use Only
Guarantees: This antibody carries the LSBio 100% Guarantee. ✓
Category: Antibodies > Primary Antibodies > Polyclonal Antibodies
Alternative Names: MCPH7 | SIL | STIL | TAL1 (SCL) interrupting locus | SCL-interrupting locus protein | SCL/TAL1 interrupting locus
Recommended Dilution: WB: 1:500 - 1:2000
UniProt Number: Q15468
NCBI GenBank: NM_003035 | NP_003026.2
SwissProt: Q15468

Target

Target: Human STIL
Antigen Species: Human
Gene Name: STIL

Antibody

Host Species: Rabbit
Clonality: Polyclonal
Isotype: IgG

Immunogen

Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1218-1287 of human STIL (NP_003026.2). LVKNLKPSPAVNLRTGKAEFTQHPEKENEGDITIFPESLQPSETLKQMNSMNSVGTFLDVKRLRQLPKLF
Immunogen Type: Fusion Protein (e.g., GST, MBP tag)