Western blot analysis of STIP1 expression in rat testis extract (lane 1) and MCF-7 whole cell lysates (lane 2). STIP1 at 73 kD was detected using rabbit anti- STIP1 Antigen Affinity purified polyclonal antibody at 0.5 ug/mL. The blot was developed using chemiluminescence (ECL) method.
STI1 / STIP1 Antibody (aa505-543)
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Western Blot |
| Reactivity: | Bovine, Dog, Guinea Pig, Hamster, Horse, Human, Mammal (Other), Mouse, Rabbit, Rat, Sheep, Xenopus |
| Format: | Lyophilized |
$480.00each
Catalog Number: LS-C408108-100
Catalog Number: LS-C408108
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- STIP1 antibody LS-C408108 is an unconjugated rabbit polyclonal antibody to STIP1 (STI1) (aa505-543) from human. It is reactive with human, mouse, rat and other species. Validated for WB.
- Application
- WB
- Reactivity
- Bov, Can, GP, Ham, Hr, Hu, Mml, Ms, Rb, Rt, Sh, Xen
- Intended Use
- Research Use Only
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- HOP | IEF-SSP-3521 | NY-REN-11 antigen | p60 | STIP1 | STI1 | Hsc70/Hsp90-organizing protein | Hsp70/Hsp90-organizing protein | STI1L
- UniProt Number
- P31948
- NCBI GenBank
- NM_006819 | NP_006810.1
- SwissProt
- P31948
Target
- Target
- Human STI1 / STIP1
- Antigen Species
- Human
- Gene Name
- STIP1
Antibody
- Host Species
- Rabbit
- Clonality
- Polyclonal
Immunogen
- Immunogen
- A synthetic peptide corresponding to a sequence at the C-Terminus of human STIP1 (505-543 aa RLILEQMQKDPQALSEHLKNPVIAQKIQKLMDVGLIAIR), identical to the related mouse and rat sequences.
- Immunogen Type
- Synthetic Peptide (Linear)
Format
- Conjugate/Label
- Unconjugated
- Format
- Lyophilized
- Formulation
- Lyophilized from 0.2mg Na2HPO4, 5mg BSA, 0.9mg NaCl, 0.05mg sodium azide.
- Preservative
- Yes
- Purification Method
- Affinity Purified
Storage & Handling
- Storage Conditions
- At -20°C for 1 year. After reconstitution, at 4°C for 1 month. It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid freeze-thaw cycles.
- Recommended Storage Buffer
- NaCl