Human Apolipoprotein H Antibody (IgG) ELISA Kit (Sandwich ELISA)
Catalog Number: LS-F67372-1
1 plate / $591.00
Reactivity: Human
Detection Method Colorimetric
Format: 96-Well Strip Plate
STAT6 Antibody
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Western Blot |
| Reactivity: | Human, Rat |
| Format: | Lyophilized |
$587.00each
Catalog Number: LS-C490084-100
Catalog Number: LS-C490084
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- STAT6 antibody LS-C490084 is an unconjugated rabbit polyclonal antibody to STAT6 from human. It is reactive with human and rat. Validated for WB.
- Application
- WB
- Reactivity
- Hu, Rt
- Intended Use
- Research Use Only
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- D12S1644 | IL-4-STAT | STAT6 | Stat-6 | STAT6B | STAT6C | STAT, interleukin4-induced | IL-4 Stat | Transcription factor IL-4 STAT
- Recommended Dilution: WB
- 0.1 - 0.5 µg/ml
- UniProt Number
- P42226
- NCBI GenBank
- NM_003153 | NP_003144.3
- SwissProt
- P42226
Target
- Target
- Human STAT6
- Antigen Species
- Human
- Gene Name
- STAT6
Antibody
- Host Species
- Rabbit
- Clonality
- Polyclonal
- Isotype
- IgG
Immunogen
- Immunogen
- Amino acids ESIYQRDPLKLVATFRQILQGEKKAVMEQFR of human STAT6 were used as the immunogen for the STAT6 antibody.
- Immunogen Type
- Peptide
Format
- Conjugate/Label
- Unconjugated
- Format
- Lyophilized
- Formulation
- Lyophilized from PBS, 2.5% BSA, 0.025% sodium azide.
- Preservative
- Yes
- Purification Method
- Affinity Purified
Storage & Handling
- Storage Conditions
- Store at -20°C. Avoid freeze-thaw cycles.
- Recommended Storage Buffer
- PBS
