Human Apolipoprotein H Antibody (IgG) ELISA Kit (Sandwich ELISA)
Catalog Number: LS-F67372-1
1 plate / $591.00
Reactivity: Human
Detection Method Colorimetric
Format: 96-Well Strip Plate
STAT3 Antibody (aa688-722)
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Immunocytochemistry, Immunoprecipitation, Other, Western Blot |
| Reactivity: | Bovine, Hamster, Horse, Human, Mouse, Non-Human Primate, Pig, Rat |
| Format: | Liquid |
$849.00each
Catalog Number: LS-C10382-200
Catalog Number: LS-C10382
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- STAT3 antibody LS-C10382 is an unconjugated rabbit polyclonal antibody to STAT3 (aa688-722) from human. It is reactive with human, mouse, rat and other species. Validated for GS, ICC, IP and WB.
- Application
- ICC, IP, Other, WB
- Reactivity
- Bov, Ham, Hr, Hu, Ms, NHP, Por, Rt
- Intended Use
- Research Use Only
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- Acute-phase response factor | APRF | DNA-binding protein APRF | HIES | STAT3
- UniProt Number
- P40763
- NCBI GenBank
- NM_003150|NP_003141.2
- SwissProt
- P40763
Target
- Target
- Human STAT3
- Antigen Species
- Human
- Epitope
- Recognizes STAT3 (92kD). A second unknown band at 50kD may be observed with longer exposures or at high concentrations of the antibody. Species cross-reactivity: Human, rat and mouse.
- Gene Name
- STAT3
Antibody
- Host Species
- Rabbit
- Clonality
- Polyclonal
- Isotype
- IgG
- Origin Species
- Human
Immunogen
- Immunogen
- Bacterially expressed GST fusion protein corresponding to human STAT3 (aa 688-722, RPESQEHPEADPGSAAPYLKTKFICVTPTTCSNTI). The immunizing sequence is identical in mouse and rat STAT3. The first 28 amino acids are identical to mouse STAT3B. Percent identity by BLAST analysis: Human, Gorilla, Orangutan, Gibbon, Monkey, Marmoset, Mouse, Rat, Hamster, Elephant, Panda, Bovine, Horse, Pig, Opossum (100%); Sheep (97%); Chicken (84%).
- Immunogen Type
- Fusion Protein (e.g., GST, MBP tag)
Format
- Conjugate/Label
- Unconjugated
- Format
- Liquid
- Formulation
- 0.1 M Tris-glycine, pH 7.4, 0.15 M sodium chloride, 0.05% sodium azide, 40% glycerol.
- Preservative
- Yes
- Purification Method
- Protein A Affinity
Storage & Handling
- Storage Conditions
- Short term: store at 4°C. Long term: store at -20°C. Avoid freeze-thaw cycles.
- Recommended Storage Buffer
- 0.1 M Tris-glycine|0.15 M sodium chloride
