Human Apolipoprotein H Antibody (IgG) ELISA Kit (Sandwich ELISA)
Catalog Number: LS-F67372-1
1 plate / $591.00
Reactivity: Human
Detection Method Colorimetric
Format: 96-Well Strip Plate
Western blot testing of human HeLa cell lysate with SRY antibody at 0.5ug/ml. Predicted molecular weight ~24 kDa.
SRY Antibody
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Western Blot |
| Reactivity: | Human |
| Format: | Lyophilized |
$587.00each
Catalog Number: LS-C782829-100
Catalog Number: LS-C782829
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- SRY antibody LS-C782829 is an unconjugated rabbit polyclonal antibody to human SRY. Validated for WB.
- Application
- WB
- Reactivity
- Hu
- Intended Use
- Research Use Only
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- Sex determining region protein | Sex-determining region on Y | SRXX1 | SRXY1 | TDF | SRY | Testis-determining factor | Sex determining region Y | TDY
- Recommended Dilution: WB
- 0.5 - 1 µg/ml
- UniProt Number
- Q05066
- NCBI GenBank
- NM_003140 | NP_003131.1
- SwissProt
- Q05066
Target
- Target
- Human SRY
- Antigen Species
- Human
- Gene Name
- SRY
Antibody
- Host Species
- Rabbit
- Clonality
- Polyclonal
- Isotype
- IgG
- Origin Species
- Human
Immunogen
- Immunogen
- Amino acids 90-130 (ISKQLGYQWKMLTEAEKWPFFQEAQKLQAMHREKYPNYKYR) were used as the immunogen for the SRY antibody.
Format
- Conjugate/Label
- Unconjugated
- Format
- Lyophilized
- Formulation
- Lyophilized from PBS, 2.5% BSA, 0.025% sodium azide.
- Preservative
- Yes
- Purification Method
- Affinity Purified
Storage & Handling
- Storage Conditions
- After reconstitution, store at 4°C for up to 1 month. Long-term: aliquot and store at -20°C. Avoid freeze-thaws cycles.
- Recommended Storage Buffer
- PBS
